Function
May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Plays a key role as a component of the TAC1-mediated telomerase activation pathway certainly by targeting a telomerase repressor to degradation. Seems to occupy an integral position in a complex signaling network that perceives, integrates, and responds to multiple, and sometimes competing, signals. Enhances responses to auxin in postgermination and vegetative development. Also negatively regulates ABA- and sugar-mediated inhibition of the germination. Essential for female and male gametophyte development.
Sequence
MEAVLVAMSVPATTEDDGFSLITDKLSYNLTPTSDVEIVTSDNRRIPAHSGVLASASPVLMNIMKKPMRRYRGCGSKRVIKILGVPCDAVSVFIKFLYSSSLTEDEMERYGIHLLALSHVYMVTQLKQRCSKGVVQRLTTENVVDVLQLARLCDAPDVCLRSMRLIHSQFKTVEQTEGWKFIQEHDPFLELDILQFIDDAESRKKRRRRHRKEQDLYMQLSEAMECIEHICTQGCTLVGPSNVVDNNKKSMTAEKSEPCKAFSTCYGLQLLIRHFAVCKRRNNDKGCLRCKRMLQLFRLHSLICDQPDSCRVPLCRQFRKRGEQDKKMGEDTKWKLLVTRVVSAKAMTSLCQSKKNKCEQAQGV