Bsph1

Binder of sperm protein homolog 1

133 amino acids

Binds sperm in vitro and promotes sperm capacitation (PubMed:22539676, PubMed:24307707). Specifically promotes capacitation induced by high density lipoproteins (HDLs) (PubMed:25602034). Also binds heparin, phospholipid liposomes, and weakly to gelatin (PubMed:22539676). Does not bind chondroitin sulfate B (PubMed:22539676).

Belongs to the seminal plasma protein family.

16.014 kDa

MAQPLDFLLVSICLFHSLFSFQVEDYYAPTIESLIRNPETEDGACVFPFLYRSEIFYDCVNFNLKHKWCSLNKTYQGYWKYCALSDYAPCAFPFWYRHMIYWDCTEDGEVFGKKWCSLTPNYNKDQVWKYCIE

BSPH1

Binder of sperm protein homolog 1

132 amino acids

Binds sperm in vitro and promotes sperm capacitation. Specifically promotes capacitation induced by high density lipoproteins (HDLs). Also binds heparin, phospholipid liposomes, and weakly to gelatin. Does not bind chondroitin sulfate B.

Belongs to the seminal plasma protein family.

15.693 kDa

MGSLMLLFVETTRNSSACIFPVILNELSSTVETITHFPEVTDGECVFPFHYKNGTYYDCIKSKARHKWCSLNKTYEGYWKFCSAEDFANCVFPFWYRRLIYWECTDDGEAFGKKWCSLTKNFNKDRIWKYCE