Function
Component of the cytosolic iron-sulfur (Fe-S) protein assembly (CIA) machinery. Required for the maturation of extramitochondrial Fe-S proteins. Part of an electron transfer chain functioning in an early step of cytosolic Fe-S biogenesis, facilitating the de novo assembly of a [4Fe-4S] cluster on the cytosolic Fe-S scaffold complex. Electrons are transferred from NADPH via a FAD- and FMN-containing diflavin oxidoreductase. Together with the diflavin oxidoreductase, also required for the assembly of the diferric tyrosyl radical cofactor of ribonucleotide reductase (RNR), probably by providing electrons for reduction during radical cofactor maturation in the catalytic small subunit.
Sequence
MDYVSPGHSVLLLWGGAVSGDTIQTTVGNLQTKVGEKGHVRVEHVDRLLLSNHGSSTFDVVMSGTINPPTTVHSGDVLAEVARLLKPSGRAVVCEPTVSTDNGGTLRTAAKLSSSLKLAGLVSVSEAKEVSLSQQEHDLLKQALSVDGIQVVEVSASKPSYEVGSSAQLTLSFAKKKQVEKPKLDENTAKIWSLSAVDMNDDDIDLLDPDELLDEEDLKKPDPASLKAQCGTGGDTKKRKACKNCTCGLAEELEGDQPGKTASKPATSACGNCYLGDAFRCASCPYLGMPAFKPGEKITLTDRQLKGDI