About Services Proteins Contact

BLi00565

Gene
BLi00565
Protein
Protein SprT-like
Organism
Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46)
Length
153 amino acids
Similarity
Belongs to the SprT family.
Mass
18.173 kDa
Sequence
MDEQQLQQLTEQLSLTYFKKPFRHRAYFNSRLKTTGGRYLLNSHNIELNKKYLTEHGQKELEGIIKHELCHYHLHLEGKGYKHRDKDFRTLLKEVGAPRFCTPLEKEKKPQRKVRTYKCEACGQTFLRKRKMDTSRYVCGKCGGKIKEIIKKG