About Services Proteins Contact

BIN3

Gene
bin3
Protein
Probable RNA methyltransferase bin3
Organism
Drosophila melanogaster
Length
1367 amino acids
Function
S-adenosyl-L-methionine-dependent methyltransferase that adds a methylphosphate cap at the 5'-end of 7SK snRNA, leading to stabilize it (Probable). Required for dorso-ventral patterning in oogenesis and for anterior-posterior pattern formation during embryogenesis, possibly by binding and stabilizing 7SK RNA, thereby promoting formation of a repressive RNA-protein complex.
Similarity
Belongs to the methyltransferase superfamily.
Mass
146.234 kDa
Sequence
MEKRLSDSPGDCRVTRSTMTPTLRLDQTSRQEPLPQQPDNGPAAAPGKSKSPTPLPGKSQAAQHHQFRAPQQQQGPKNRNKAWSKRQHKAGGKHNPSACVGASSGQAQSTGSSVIAATLLPTAASAHKADLENIQNIHNKNLTAGGGVNHHGNAGTAHHGGGGGAGAHHAAAGGHHHHHNTRLAQNAAAGGASGGGTIQMHKKMLRGHHHHVLCAGNNANHTCCLVTGCNGSSIGGVGVAGSGGATASAGGGGASCKEAQSCKDTSSLSGNSSIAGSAGAGNAVHYCCGRSKFFLPEKRLRKEVIVPPTKFLLGGNISDPLNLNSLQNENTSNASSTNNTPATTPRQSPITTPPKVEVIIPPNIHDPLHLLDPVDSMEYEKQLTSPMKRAGPGGGMLHHRQHHYRTRKNRKRRRFDSNNTSHAGDEGGVGSELTDEPPLPAATSSLAASPVAAPLNVGGSLLLSESAAPAPGETAEMGQQQEQAHVHSPQSASTTTTAAEMPTPTPTSAAAATATAEHKEQSAPAPTATSSPQRQQQHVAAAAEELPTPETSAAAETPAEEMLLSCSATSASLVASTLAERRASRDLRLDLSSTCYGVGGTGLSFGGSISSSVGSSFGGGGRKRKISESSTSQKSKKFHRHDAMDKIVSPVVPQPGAWKRPPRILQPSGARKPSTRRSTSVSESELLSPVEEQPPKQLPLIGVEIPRDDTPDLPDHGLGSPLSTTSGATSHTAGEQDSLAGVDISMGDTLGSGVVGKAPLTSSLMLEPAKIPPIKMLPKFRADGLKYRYGNFDRYVDFRQMNEFRDVRLQVFQRHVELFENKDILDIGCNVGHMTITVARHLAPKTIVGIDIDRELVARARRNLSIFVRIPKEEKLLEVKAEPTVDAKANIAVKDETSGAAHKKTRRGKRRRKVHQGIHHHHHHHHDLEQLQQQQKLNSLLVKPHEFFPISFPLTYGRIPRILSSSKSPNMLGNKNQFPANVFFRHTNYVLKDESLMASDTQQYDLILCLSVTKWIHLNFGDNGLKMAFKRMFNQLRPGGKLILEAQNWASYKKKKNLTPEIYNNYKQIEFFPNKFHEYLLSSEVGFSHSYTLGVPRHMNKGFCRPIQLYAKGDYTPNHVRWSDAYYPQTPYEAYRGIYATLPVHRMGGGGSSAGGSNSGHAQMLHLSSSSRSQNYDTPHYAGSASGSASCRQTPMYQPTYNPLETDSYQPSYDMEYLNHMYVFASPLYQTVWSPPASLRKSSSHTPVFGSVRDAELDGDGSGGGGSGGGSYHRHVYPPNDDTCSPNANACNAFNSIRDADTDDSNQLPGGSRRHVYATNCGESSSSPQVNHHDAVGEFVDGLMDDEQKSSTGGGTGGAAYCDLSDA

Gene
BIN3
Protein
Bridging integrator 3
Organism
Homo sapiens
Length
253 amino acids
Function
Involved in cytokinesis and septation where it has a role in the localization of F-actin.
Mass
29.665 kDa
Sequence
MSWIPFKIGQPKKQIVPKTVERDFEREYGKLQQLEEQTRRLQKDMKKSTDADLAMSKSAVKISLDLLSNPLCEQDQDLLNMVTALDTAMKRMDAFNQEKVNQIQKTVIEPLKKFGSVFPSLNMAVKRREQALQDYRRLQAKVEKYEEKEKTGPVLAKLHQAREELRPVREDFEAKNRQLLEEMPRFYGSRLDYFQPSFESLIRAQVVYYSEMHKIFGDLSHQLDQPGHSDEQRERENEAKLSELRALSIVADD

Gene
Bin3
Protein
Bridging integrator 3
Organism
Mus musculus
Length
253 amino acids
Function
Involved in cytokinesis and septation where it has a role in the localization of F-actin.
Mass
29.651 kDa
Sequence
MSWIPFKIGQPKKQIVSKTVERDFEREYGKLQQLEEQTKRLQKDMKKSTDADLAMSKSAVKISQDLLSNPLCEQDQDFLHMVTALDTAMKRMDAFNQEKVNQIQKTVIEPLKKFSSIFPSLNMAVKRREQALQDYGRLQAKVEKYEEKEKTGPVLAKLHQAREELRPVREDFEAKNKQLLDEMPRFYGSRLDYFQPSFESLIRAQVIYYSEMHKIFGDLTQQLDQPGHSDEQRERENETKLSELRALSIVADD

Gene
Bin3
Protein
Bridging integrator 3
Organism
Rattus norvegicus
Length
253 amino acids
Function
Involved in cytokinesis and septation where it has a role in the localization of F-actin.
Mass
29.691 kDa
Sequence
MSWIPFKIGQPKKQIVSKTVERDFEREYGKLQQLEEQTKRLQKDMKKSTDADLAMSKSAVKISLDLLSNPLCEQDQDFLRMVTALDTAMKRMDAFNQEKVNQIQKTVIEPLKKFGSIFPSLNMAVKRREQALQDYGRLQAKVEKYEEKEKTGPVLAKLHQAREELRPVREDFEAKNKQLLDEMPRFYNSRLDYFQPSFESLIRAQVIYYSEMHKIFGDLTQQLDQPGHSDEHRERENETKLSELRALSIVADD

Gene
bin3
Protein
Bridging integrator 3 homolog
Organism
Xenopus laevis
Length
252 amino acids
Function
Involved in cytokinesis and septation where it has a role in the localization of F-actin.
Mass
29.383 kDa
Sequence
MSWNLFKGGPKKQIVPKTVERDFEREYGKLQQLEDQIKKLQKDMKKSIEADLAMSKSAVRISSDLLGNPLCEPDVDFLQMVTALDTAMKRMDAFNQEKVNQIQKTVMDPLKRYSSVFPSLNMAVKRREQALQDYKRLQTKVEKYEEKDKTGAMIAKLHQAREELRPVRDDFEAKNHQLLDEMPKFYNSRTDFFKPSFQSLIRAQVVYYTEMSRVFGDLAQQVDEVQLSDAEREQENEARLAELRSLSIVADD

Gene
bin3
Protein
Putative transposon Tn552 DNA-invertase bin3
Organism
Staphylococcus aureus
Length
202 amino acids
Function
Potential DNA invertase.
Similarity
Belongs to the site-specific recombinase resolvase family.
Mass
23.36 kDa
Sequence
MIIGYARVSSLDQNLERQLENLKTFGAEKIFTEKQSGKSIENRPILQKALNFVRMGDRFIVESIDRLGRNYNEVIHTVNYLKDKEVQLMITSLPMMNEVIGNPLLDKFMKDLIIQILAMVSEQERNESKRRQAQGIQVAKEKGVYKGRPLLYSPNAKDPQKRVIYHRVVEMLEEGQAISKIAKEVNITRQTVYRIKHDNGLS