Protein
Serine/threonine-protein kinase BGLF4
Organism
Epstein-Barr virus (strain AG876)
Function
Plays many key roles by phosphorylating several proteins including the viral DNA processivity factor BMRF1, EBNA1 or EBNA2. Modifies the host nuclear envelope structure and induces the redistribution of nuclear envelope-associated proteins by phosphorylating host nucleoporins. Subsequently, promotes the nuclear transport of EBV lytic proteins. Required for efficient lytic DNA replication and release of nucleocapsids from the nucleus. Contributes to the compaction of host cell chromatin in cells undergoing lytic replication, presumably by phosphorylating the host condensin complex and host TOP2A. Induces disassembly of the nuclear lamina by phosphorylating with host LMNA. Phosphorylates substrates involved in capsid assembly and DNA packaging. Facilitates the switch from latent to lytic DNA replication by down-regulating EBNA1 replication function. Phosphorylates the viral immediate-early protein BZLF1 and inhibits its sumoylation by interacting with host SUMO1 and SUMO2.
Similarity
Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.
Sequence
MDVNMAAELSPTNSSSSGELSVSPEPPRETQAFLGKVTVIDYFTFQHKHLKVTNIDDMTETLYVKLPENMTRCDHLPITCEYLLGRGSYGAVYAHADNATVKLYDSVTELYHELMVCDMIQIGKATAEDGQDKALVDYLSACTSCHALFMPQFRCSLQDYGHWHDGSIEPLVRGFQGLKDAVYFLNRHCGLFHSDISPSNILVDFTDTMWGMGRLVLTDYGTASLHDRNKMLDVRLKSSKGRQLYRLYCQREPFSIAKDTYKPLCLLSKCYILRGAGHIPDPSACGPVGAQTALRLDLQSLGYSLLYGIMHLADSTHKIPYPNPDMGFDRSDPLYFLQFAAPKVVLLEVLSQMWNLNLDMGLTSCGESPCVDVTAEHMSQFLQWCRSLKKRFKESYFFNCRPRFEHPHLPGLVAELLADDFFGPDGRRG