BEX4

Protein BEX4

120 amino acids

May play a role in microtubule deacetylation by negatively regulating the SIRT2 deacetylase activity toward alpha-tubulin and thereby participate to the control of cell cycle progression and genomic stability.

Belongs to the BEX family.

14.067 kDa

MESKEELAANNLNGENAQQENEGGEQAPTQNEEESRHLGGGEGQKPGGNIRRGRVRRLVPNFRWAIPNRHIEHNEARDDVERFVGQMMEIKRKTREQQMRHYMRFQTPEPDNHYDFCLIP

BEX4

Protein BEX4

119 amino acids

May play a role in microtubule deacetylation by negatively regulating the SIRT2 deacetylase activity toward alpha-tubulin and thereby participate to the control of cell cycle progression and genomic stability.

Belongs to the BEX family.

14.051 kDa

MESKEELAANNLNGENAQQENEGREQAPTQNEETRHLGGGEGQKPGGNIRRGRVRRLVPNFRWAIPNRHIEHNEARDDVERFVGQMMEIKRKTREQQMRHYMRFQTPEPDNHYDFCLIP

Bex4

Protein BEX4

118 amino acids

May play a role in microtubule deacetylation by negatively regulating the SIRT2 deacetylase activity toward alpha-tubulin and thereby participate to the control of cell cycle progression and genomic stability.

Belongs to the BEX family.

13.82 kDa

MASKFKQVILDLTVEKDKKDKKGGKASKQSEEEPHHLEEVENKKPGGNVRRKVRRLVPNFLWAIPNRHVDRNEGGEDVGRFVVQGTEVKRKTTEQQVRPYRRFRTPEPDNHYDFCLIP

Bex4

Protein BEX4

118 amino acids

May play a role in microtubule deacetylation by negatively regulating the SIRT2 deacetylase activity toward alpha-tubulin and thereby participate to the control of cell cycle progression and genomic stability.

Belongs to the BEX family.

13.721 kDa

MASKVKQVILDLTVEKDKKNKKGGKASKQSEEESHHLEEVENKKPGGNVRRKVRRLVPNFLWAIPNRHVDHSEGGEEVGRFVGQVMEAKRKSKEQQMRPYTRFRTPEPDNHYDFCLIP