About Services Proteins Contact

BCAT6

Gene
BCAT6
Protein
Branched-chain-amino-acid aminotransferase 6
Organism
Arabidopsis thaliana
Length
356 amino acids
Function
Converts 2-oxo acids to branched-chain amino acids. Acts on leucine, isoleucine and valine (By similarity).
Similarity
Belongs to the class-IV pyridoxal-phosphate-dependent aminotransferase family.
Mass
38.861 kDa
Sequence
MAPSSSPLRTTSETDEKYANVKWEELGFALTPIDYMYVAKCRQGESFTQGKIVPYGDISISPCSPILNYGQGLFEGLKAYRTEDDRIRIFRPDQNALRMQTGAERLCMTPPTLEQFVEAVKQTVLANKKWVPPPGKGTLYIRPLLLGSGATLGVAPAPEYTFLIYASPVGDYHKVSSGLNLKVDHKYHRAHSGGTGGVKSCTNYSPVVKSLLEAKSAGFSDVLFLDAATGRNIEELTACNIFIVKGNIVSTPPTSGTILPGVTRKSISELAHDIGYQVEERDVSVDELLEAEEVFCTGTAVVVKAVETVTFHDKKVKYRTGEAALSTKLHSMLTNIQMGVVEDKKGWMVDIDPCQG