About Services Proteins Contact

BCAH820_4467

Gene
BCAH820_4467
Protein
UPF0297 protein BCAH820_4467
Organism
Bacillus cereus (strain AH820)
Length
88 amino acids
Similarity
Belongs to the UPF0297 family.
Mass
10.33 kDa
Sequence
MDGFDKTMKFSIQDEKQSVHVNDVLLTVYDALQEKGYNPINQIVGYLLSGDPAYIPRHKDARSIIRKLERDELIEELVKSYLKHHREE