About Services Proteins Contact

BCAH187_A1726

Gene
BCAH187_A1726
Protein
UPF0398 protein BCAH187_A1726
Organism
Bacillus cereus (strain AH187)
Length
184 amino acids
Similarity
Belongs to the UPF0398 family.
Mass
21.51 kDa
Sequence
MKVIAVTGYKPFELGIFKNDHPGVECIKKALRRKLTAFVEDGLEWVIISGQLGVELWAAEVVFEIQVEYPDLKLAVFTPFLEQEEGWKEDNREYYEFILSQADHVDSITKRKYESPEQFKLKNQFFIEKSDALLAVYDEEKPGSPKYIVEAAKKKGEIENYHSYFILFSDLQDIIEEEQWNNAE