About Services Proteins Contact

BCAH187_A1308

Gene
BCAH187_A1308
Protein
UPF0344 protein BCAH187_A1308
Organism
Bacillus cereus (strain AH187)
Length
120 amino acids
Similarity
Belongs to the UPF0344 family.
Mass
13.545 kDa
Sequence
MVHMHITAWALGLILFFVAYSLYSAGRKGKGVHMGLRLMYIIIIVTGVWLYLDQTIVDKSYHMWYGLKMLAGILVIAGMEMVLVKMSKNKATGAFWGLFIIALVAVFYLGLKLPIGWQVF