About Services Proteins Contact

BCAH187_A0027

Gene
BCAH187_A0027
Protein
Nucleoid-associated protein BCAH187_A0027
Organism
Bacillus cereus (strain AH187)
Length
109 amino acids
Function
Binds to DNA and alters its conformation. May be involved in regulation of gene expression, nucleoid organization and DNA protection.
Similarity
Belongs to the YbaB/EbfC family.
Mass
11.863 kDa
Sequence
MMRGGMGNMNNMMKQMQKMQKEMAKAQEELGEKTVEGTAGGGMITVIANGHKQILEVKVKEEVVDPEDIEMLQDLVLAATNDALKKADELSNSTMGKFTKGLNLPGGMF