BARX1

Homeobox protein BarH-like 1

254 amino acids

Transcription factor, which is involved in craniofacial development, in odontogenesis and in stomach organogenesis. May have a role in the differentiation of molars from incisors. Plays a role in suppressing endodermal Wnt activity (By similarity). Binds to a regulatory module of the NCAM promoter.

Belongs to the BAR homeobox family.

27.298 kDa

MQRPGEPGAARFGPPEGCADHRPHRYRSFMIEEILTEPPGPKGAAPAAAAAAAGELLKFGVQALLAARPFHSHLAVLKAEQAAVFKFPLAPLGCSGLSSALLAAGPGLPGAAGAPHLPLELQLRGKLEAAGPGEPGTKAKKGRRSRTVFTELQLMGLEKRFEKQKYLSTPDRIDLAESLGLSQLQVKTWYQNRRMKWKKIVLQGGGLESPTKPKGRPKKNSIPTSEQLTEQERAKDAEKPAEVPGEPSDRSRED

Barx1

Homeobox protein BarH-like 1

254 amino acids

Transcription factor, which is involved in craniofacial development, in odontogenesis and in stomach organogenesis. May have a role in the differentiation of molars from incisors. Plays a role in suppressing endodermal Wnt activity. Binds to a regulatory module of the NCAM promoter.

Belongs to the BAR homeobox family.

27.282 kDa

MQRPGEPGAARFGPPEGCADHRPHRYRSFMIEEILTEPPGPKGAAPAAAAAAAGELLKFGVQALLAARPFHSHLAVLKAEQAAVFKFPLAPLGCSGLGSALLAAGPGMPGPAGASHLPLELQLRGKLEAAGSGEPGAKAKKGRRSRTVFTELQLMGLEKRFEKQKYLSTPDRIDLAESLGLSQLQVKTWYQNRRMKWKKIVLQGGGLESPTKPKGRPKKNSIPTSEQLTEQERAKETEKPAETPGEPSDRNCED

barx1

Homeobox protein BarH-like 1

248 amino acids

Transcription factor, is involved in craniofacial development, and in stomach organogenesis.

Belongs to the BAR homeobox family.

27.558 kDa

MQHPLEIGAHYYPPDAHLDQRSHRYRSFMIEEILTDHPDQKISSPTGDLLKFGVHALLSARPYHNHLVLKADQTGILKFPVSPLSCSLGAPLSSALLSGAAGLQVGSSSHHLPLDLHLRGKLDPGADAVSKTKKGRRSRTVFTELQLMGLEKRFEKQKYLSTPDRIDLAESLGLSQLQVKTWYQNRRMKWKKIVLQGGGLESPTKPKGRPKKNSIPTSEQLSEQERTREADRLSDGGASSLSDANQEE

BARX1

Homeobox protein BarH-like 1

207 amino acids

Transcription factor, which is involved in craniofacial development, in odontogenic region definition, and in stomach organogenesis. Binds to a regulatory module of the NCAM promoter.

Belongs to the BAR homeobox family.

22.468 kDa

single

ANERPPGSCSSSGCRRCCRPGPYHSHLAVLKAEQAAVFKFPLAPLGCSGLGSALLAAGPGMPGPAGASHLPLELQLRGKLEAAGSGEPGSKAKKGRRSRTVFTELQLMGLEKRFEKQKYLSTPDRIDLAESLGLSQLQVKTWYQNRRMKWKKIVLQGGGLESPTKPKGRPKKNSIPSSEQLSEQERAKETEKPPESPGEPSERQQEE