About Services Proteins Contact

BAP1

Gene
bap1
Protein
Ubiquitin carboxyl-terminal hydrolase BAP1
Organism
Danio rerio
Length
755 amino acids
Function
Deubiquitinating enzyme that plays a key role in chromatin by mediating deubiquitination of histone H2A. Catalytic component of the PR-DUB complex, a complex that specifically mediates deubiquitination of histone H2A monoubiquitinated at 'Lys-119' (H2AK119ub1) (By similarity).
Similarity
Belongs to the peptidase C12 family. BAP1 subfamily.
Mass
83.777 kDa
Sequence
MNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQSPVYGFIFLFKWIEERRSRRKVSTLVDETSVIDDDIVNDMFFAHQLIPNSCATHALLSVLLNCSGVELGMTLSRMKAFTKGFNPESKGYAIGNAPELAKAHNSHARPEPRHLPEKQNGISAVRTMEAFHFVSYVPIKDRLFELDGLKAYPIDHGPWGEDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRIKYESKLDILKRNRQIILEGLQQIREKKVIRMTQQESGQDRKQQDSSSSEDTPPVVKKEEVQETPIPSGAEQATPTEAQEGAASLPSPAGKVRSMAKPALPAGGAPPPAPLPAPSTNTIVQRLPAFLDNHNYAKSPMQEEEDLAAGVGRSRPPQPPYSDDEDDYDDEEEECSTAGVTNSRVRRKLGLRTRTMSRTAVGGVAAMEGQLALSVLAEKLKKEVQRKDALATTGSTPLNVRTEGRTGGISITSACQPSPTPSNESTDTASEIGSAFNSPLRSPARSQATTRPSSPVASHVGRVLFGEEEGLPRLDARHNRAVRDLGVLVSSTQLQLQEDGVIFALPPTEALEGLKKVGGVDKKKKEEASGPGGEEEVKEGPSVEMKAEDVKESVDVKPEKENLPTTDVENSTKPPGEKYTPKELLALLKYVEADIANYEVYLKEEVEKRKKYKIDDQRRTHNYDEFICTFISMLAQEGMLASLVEQNISVRRRQGVSIGRLHKQRKPDRRKRSRPYKAKRQ

Gene
BAP1
Protein
Ubiquitin carboxyl-terminal hydrolase BAP1
Organism
Homo sapiens
Length
729 amino acids
Function
Deubiquitinating enzyme that plays a key role in chromatin by mediating deubiquitination of histone H2A and HCFC1 (PubMed:12485996, PubMed:18757409, PubMed:20436459, PubMed:25451922). Catalytic component of the PR-DUB complex, a complex that specifically mediates deubiquitination of histone H2A monoubiquitinated at 'Lys-119' (H2AK119ub1) (PubMed:20436459, PubMed:25451922). Does not deubiquitinate monoubiquitinated histone H2B (PubMed:20436459). Acts as a regulator of cell growth by mediating deubiquitination of HCFC1 N-terminal and C-terminal chains, with some specificity toward 'Lys-48'-linked polyubiquitin chains compared to 'Lys-63'-linked polyubiquitin chains (PubMed:19188440, PubMed:19815555). Deubiquitination of HCFC1 does not lead to increase stability of HCFC1 (PubMed:19188440, PubMed:19815555). Interferes with the BRCA1 and BARD1 heterodimer activity by inhibiting their ability to mediate ubiquitination and autoubiquitination (PubMed:19117993). It however does not mediate deubiquitination of BRCA1 and BARD1 (PubMed:19117993). Able to mediate autodeubiquitination via intramolecular interactions to couteract monoubiquitination at the nuclear localization signal (NLS), thereby protecting it from cytoplasmic sequestration (PubMed:24703950). Acts as a tumor suppressor (PubMed:9528852).
Similarity
Belongs to the peptidase C12 family. BAP1 subfamily.
Mass
80.362 kDa
Sequence
MNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQGPVYGFIFLFKWIEERRSRRKVSTLVDDTSVIDDDIVNNMFFAHQLIPNSCATHALLSVLLNCSSVDLGPTLSRMKDFTKGFSPESKGYAIGNAPELAKAHNSHARPEPRHLPEKQNGLSAVRTMEAFHFVSYVPITGRLFELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRIKYEARLHVLKVNRQTVLEALQQLIRVTQPELIQTHKSQESQLPEESKSASNKSPLVLEANRAPAASEGNHTDGAEEAAGSCAQAPSHSPPNKPKLVVKPPGSSLNGVHPNPTPIVQRLPAFLDNHNYAKSPMQEEEDLAAGVGRSRVPVRPPQQYSDDEDDYEDDEEDDVQNTNSALRYKGKGTGKPGALSGSADGQLSVLQPNTINVLAEKLKESQKDLSIPLSIKTSSGAGSPAVAVPTHSQPSPTPSNESTDTASEIGSAFNSPLRSPIRSANPTRPSSPVTSHISKVLFGEDDSLLRVDCIRYNRAVRDLGPVISTGLLHLAEDGVLSPLALTEGGKGSSPSIRPIQGSQGSSSPVEKEVVEATDSREKTGMVRPGEPLSGEKYSPKELLALLKCVEAEIANYEACLKEEVEKRKKFKIDDQRRTHNYDEFICTFISMLAQEGMLANLVEQNISVRRRQGVSIGRLHKQRKPDRRKRSRPYKAKRQ

Gene
Bap1
Protein
Ubiquitin carboxyl-terminal hydrolase BAP1
Organism
Mus musculus
Length
728 amino acids
Function
Deubiquitinating enzyme that plays a key role in chromatin by mediating deubiquitination of histone H2A and HCFC1. Catalytic component of the PR-DUB complex, a complex that specifically mediates deubiquitination of histone H2A monoubiquitinated at 'Lys-119' (H2AK119ub1). Does not deubiquitinate monoubiquitinated histone H2B. Acts as a regulator of cell growth by mediating deubiquitination of HCFC1 N-terminal and C-terminal chains, with some specificity toward 'Lys-48'-linked polyubiquitin chains compared to 'Lys-63'-linked polyubiquitin chains. Deubiquitination of HCFC1 does not lead to increase stability of HCFC1. Interferes with the BRCA1 and BARD1 heterodimer activity by inhibiting their ability to mediate ubiquitination and autoubiquitination. It however does not mediate deubiquitination of BRCA1 and BARD1. Able to mediate autodeubiquitination via intramolecular interactions to couteract monoubiquitination at the nuclear localization signal (NLS), thereby protecting it from cytoplasmic sequestration. Acts as a tumor suppressor.
Similarity
Belongs to the peptidase C12 family. BAP1 subfamily.
Mass
80.492 kDa
Sequence
MNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQGPVYGFIFLFKWIEERRSRRKVSTLVDDTSVIDDDIVNNMFFAHQLIPNSCATHALLSVLLNCSNVDLGPTLSRMKDFTKGFSPESKGYAIGNAPELAKAHNSHARPEPRHLPEKQNGLSAVRTMEAFHFVSYVPITGRLFELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRIKYETRLHVLKVNRQTVLEALQQLIRVTQPELIQTHKSQESQLPEESKPASSKSPLGLEAGRTPVASECTQTDGAEEVAGSCPQTTTHSPPSKCKLVVKPPGSSLNGVPPNPAPIVQRLPAFLDNHNYAKSPMQEEEDLAAGVGRSRVPVRAPQQYSEDEDDYEDEDEDVQNTNPAIRYKRKGTGKPGSLSNSSDGQLSVLQPNTINVLTEKLQESQKDLSVPLSIKTSSGAGSPAVAVPTHSQPSPTPSNESTDTASEIGSAFNSPLRSPIRSANPTRPSSPVTSHISKVLFGEDDSLLRVDCIRYNRAVRDLGPVISTGLLHLAEDGVLSPLALTEGGKGSSPSTRSSQGSQGSSGLEEKEVVEVTESRDKPGLNRSSEPLSGEKYSPKELLALLKCVEAEIANYEACLKEEVEKRKKFKIDDQRRTHNYDEFICTFISMLAQEGMLANLVEQNISVRRRQGVSIGRLHKQRKPDRRKRSRPYKAKRQ

Gene
Bap1
Protein
Ubiquitin carboxyl-terminal hydrolase BAP1
Organism
Rattus norvegicus
Length
727 amino acids
Function
Deubiquitinating enzyme that plays a key role in chromatin by mediating deubiquitination of histone H2A and HCFC1. Catalytic component of the PR-DUB complex, a complex that specifically mediates deubiquitination of histone H2A monoubiquitinated at 'Lys-119' (H2AK119ub1). Does not deubiquitinate monoubiquitinated histone H2B. Acts as a regulator of cell growth by mediating deubiquitination of HCFC1 N-terminal and C-terminal chains, with some specificity toward 'Lys-48'-linked polyubiquitin chains compared to 'Lys-63'-linked polyubiquitin chains. Deubiquitination of HCFC1 does not lead to increase stability of HCFC1. Interferes with the BRCA1 and BARD1 heterodimer activity by inhibiting their ability to mediate ubiquitination and autoubiquitination. It however does not mediate deubiquitination of BRCA1 and BARD1. Able to mediate autodeubiquitination via intramolecular interactions to couteract monoubiquitination at the nuclear localization signal (NLS), thereby protecting it from cytoplasmic sequestration. Acts as a tumor suppressor.
Similarity
Belongs to the peptidase C12 family. BAP1 subfamily.
Mass
80.31 kDa
Sequence
MNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQGPVYGFIFLFKWIEERRSRRKVSTLVDDTSVIDDDIVNSMFFAHQLIPNSCATHALLSVLLNCSNVDLGPTLSRMKDFTKGFSPESKGYAIGNAPELAKAHNSHARPEPRHLPEKQNGLSAVRTMEAFHFVSYVPITGRLFELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRVKYEARLHVLKGNRQTVLEALQQLIRVTQPELIQTHKSQESQLPEESKPASSKSPFGLEAGRTPAASECTHTDGAEEVAGSCPQTTTHSPPSKSKLVVKPSGSSLNGVPPTPTPIVQRLPAFLDNHNYAKSPMQEEEDLAAGVGRSRVPVRPQQYSDDEEDYEDEEEDVQNTSSAIRYKRKGTGKPGSLSNSSDGQLSVLQPNTINVLTEKLQESQKDLSIPLSIKTSSGAGSPAVAVPTHSQPSPTPSNESTDTASEIGSAFNSPLRSPIRSANPTRPSSPVTSHISKVLFGEDDSLLRVDCIRYNRAVRDLGPVISTGLLHLAEDGVLSPLALTEGGKGSSPSTRSSQGSQGSSSLEEKEVVEVTDSRDKSGLNRSSEPLSGEKYSPKELLALLKCVEAEIANYEACLKEEVEKRKKFKIDDQRRTHNYDEFICTFISMLAQEGMLANLVEQNISVRRRQGVSIGRLHKQRKPDRRKRSRPYKAKRQ

Gene
BAP1
Protein
Ubiquitin carboxyl-terminal hydrolase BAP1
Organism
Bos taurus
Length
711 amino acids
Function
Deubiquitinating enzyme that plays a key role in chromatin by mediating deubiquitination of histone H2A and HCFC1. Catalytic component of the PR-DUB complex, a complex that specifically mediates deubiquitination of histone H2A monoubiquitinated at 'Lys-119' (H2AK119ub1). Does not deubiquitinate monoubiquitinated histone H2B. Acts as a regulator of cell growth by mediating deubiquitination of HCFC1 N-terminal and C-terminal chains, with some specificity toward 'Lys-48'-linked polyubiquitin chains compared to 'Lys-63'-linked polyubiquitin chains. Deubiquitination of HCFC1 does not lead to increase stability of HCFC1. Interferes with the BRCA1 and BARD1 heterodimer activity by inhibiting their ability to mediate ubiquitination and autoubiquitination. It however does not mediate deubiquitination of BRCA1 and BARD1. Able to mediate autodeubiquitination via intramolecular interactions to couteract monoubiquitination at the nuclear localization signal (NLS), thereby protecting it from cytoplasmic sequestration. Acts as a tumor suppressor.
Similarity
Belongs to the peptidase C12 family. BAP1 subfamily.
Mass
78.333 kDa
Sequence
MNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQGPVYGFIFLFKWIEERRSRRKVSTLVDDTSVIDDDIVNNMFFAHQLIPNSCATHALLSVLLNCSNVDLGPTLSRMKDFTKGFSPESKGYAIGNAPELAKAHNSHARPEPRHLPEKQNGLSAVRTMEAFHFVSYVPITGRLFELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGIKYEARLHVLKVNRQTVLEALQQLIRVTQPELIQTHKSQESQLPEESKPASSKSPLALETSRAPVASESTHTDGVEEVAGSCPQAPTHSPPSKPKLVVKPPGSNINGVPPNPTPIVQRLPAFLDNHNYAKSPMQEEEDLAAGVGRSRVPVRPPQQYSDDEDDYEDEEEDDAQSTSSAIRYKRKGPGKPGPLSSSGDGQLSVLQPNTINVLAEKLKESQKDLSIPLSIKTSSGAGSPAVAVPTHSQPSPTPSNESTDTASEIGSAFNSPLRSPIRSANPTRPSSPVTSHISKVLFGEDDSLLRVDCIRYNRAVRDLGPVISTGLLHLAEDGVLSPLALTESGKGSSPSIRPSQGSQGSGSPEEKEVVEAVDSREKPGLVRPSESLNGEKYSPKELLALLKCVEAEIANYEACLKEEVEKRKKFKIDDQRRTHNYDEFICTFISMLAQEGMLANLVEQNISVRRRQGVSIGRLHKQRKPDRRKRSRPYKAKRQ

Gene
BAP1
Protein
Ubiquitin carboxyl-terminal hydrolase BAP1
Organism
Gallus gallus
Length
700 amino acids
Function
Deubiquitinating enzyme that plays a key role in chromatin by mediating deubiquitination of histone H2A. Catalytic component of the PR-DUB complex, a complex that specifically mediates deubiquitination of histone H2A monoubiquitinated at 'Lys-119' (H2AK119ub1) (By similarity).
Similarity
Belongs to the peptidase C12 family. BAP1 subfamily.
Mass
77.704 kDa
Sequence
MNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQGPVYGFIFLFKWIEESRSRRKVSTLVDETSVIDDDIVNNMFFAHQLIPNSCATHALLSVLLNCNNVDLGPTLSRMKDFTKGFSPESKGYAIGNAPELAKARNSHARPEPRHLPEKQNGISAVRTMEAFHFVSYVPIKGRLFELDGLKVYPIDHGPWADDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRMKYESKLHILKMNRQTVLEALQQLIRVTQPELIQSQKSQESQSPEEAKPANSKTVAPESTHPDGADEPASQGHTTATQSPPTKSKPVAKASASSINGVPPANPNPIVQRLPAFLDNHNYAKSPMQEEEDLAAGVGRSRVPVRQHQQYSDDEDDYDDDEEEEVRNTNSAIRYKRKGQVKQEHAAGAADGQLSVLQPNTINVLAEKLKESQKDLSIPLSIKTTGGGAAVAIVTHSQPSPTPSNESTDTASEIGSAFNSPLRSPIRSANPTRPSSPVTSHISKVLFGEEDGLLRIDCLRYNRAVRDLGPIISSGLLHLTEDGVFCPLAAADGGKSSPPSIKPGEEAQVTIKLDEKEGSEASGSKEKELLALLKCVEAEIANYEACLKEEVEKRKKFKIDDQRRTHNYDEFICTFISMLAQEGMLASLVEQNISVRRRQGVSIGRLHKQRKPDRRKRSRPYKAKRQ

Gene
BAP1
Protein
Ubiquitin carboxyl-terminal hydrolase BAP1
Organism
Branchiostoma floridae
Length
694 amino acids
Function
Deubiquitinating enzyme that plays a key role in chromatin by mediating deubiquitination of histone H2A. Catalytic component of the PR-DUB complex, a complex that specifically mediates deubiquitination of histone H2A monoubiquitinated at 'Lys-119' (H2AK119ub1) (By similarity).
Similarity
Belongs to the peptidase C12 family. BAP1 subfamily.
Mass
77.164 kDa
Sequence
MNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLSKPIEGPVYGFIFLFKWSEERRSRRKVGPSMEESFVVDEDIVNDMFFAQQLIPNSCATHALLSVLLNCPQISLGSTLTRLKYFTRGMGPESKGWAIGNVPEIARAHNSHARPEPRHLPEKQTGISSVRTAEAFHFVSYVTTNDRLFELDGLKPYPIDHGPWGEKEDWTEKFRRVISERIGNATGGENGHDIRFNLMAVVADRRQQYETKLNTLKTNRQIVLEALQQVGGVNTKKSIQYAEVSHVCLHPPKFVPCSDDCAIWDALRYSSALRCSLIQHGCEHPSIPRSDGSTLVSWPSCVTSVNIVVSGHLKYVLLCFSIILDHKLEKLVPARLDPIKVNEPHLTSLIPSAFGRESHHKSKASSTVTSSSAAASSSAAGTDGVQPAEMKPDEFLHPDASRRVGFLEMPWRSDEARPLSIHTGYSKIPSPAPSNESTDTASEIGSAFNSPVRSANRSALQTIPEGSITKQEGDTKTDANIITVCLKRSLSGEGGGPPAKRLHIGDPDMALQRLGSGDSVEGDPMALQGGSGTGDAQQDQHALQAGGARPNMAHAFAPKDLLALLKNVETEIQICEQHLKDEIEKRKKYKVDDCRRTHNYDDFIRTFLRMLAEQGQLSKLVDQHVLVRRRQGVSVGRLHKQRKPDRRRKRARVSDKYRRKKQ

Gene
bap1
Protein
Ubiquitin carboxyl-terminal hydrolase BAP1
Organism
Xenopus tropicalis
Length
685 amino acids
Function
Deubiquitinating enzyme that plays a key role in chromatin by mediating deubiquitination of histone H2A. Catalytic component of the PR-DUB complex, a complex that specifically mediates deubiquitination of histone H2A monoubiquitinated at 'Lys-119' (H2AK119ub1) (By similarity).
Similarity
Belongs to the peptidase C12 family. BAP1 subfamily.
Mass
76.399 kDa
Sequence
MNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCPGPVYGFIFLFKWIEERRSRRKVSTLLDDTSVMEDEVVNNMFFAHQLIPNSCATHALLSVLLNCSGVHLGPTLSRIKEFTKGFSPESKGYAIGNAPELAKAHNSHARPEPRHLPEKQNGISAVRTMEAFHFVSYVPIKGRLFELDGLKVYPIDHGPWAEDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRLKYESKLHILKMNRQTVLEALQQLIRVTQPELIQAQKPTEGQSTEETKSAALKAPVSQESHRAHHGSHRNATDVGAEPPGALIRGPVMSAYSKPNSLAQNGGTVAAPASRLPAFLDNHNYAKSPMQEEEDLAAGVGRSRGVPPPAPDTDEEEEEETENVRRPLTPPGFKRRSSEPLPPPPGPEPGVLAEKLKETQRDLCSPLSIKTGAPTAPHSQPSPTPSNESTDTASEIGSAFNSPLRSPLRSANPTRPSSPVTLHLSKVLFGEEEPLLRLDCVRYNRAVRELGPHISTGILHLSKDGYLCPLSRLETGKVSPKGNKVEEPRESSEPDTERSRVTEVPQGEKFSPKELLALLKCVEAEISSSEACLREELEKRKKFKIDDQRRTHNYDEFICAFISMLAQEGMLASLVEQNISVRRRQGVSIGRLHKQRKPDRRKRSRPYKAKRQ

Gene
bap1
Protein
Ubiquitin carboxyl-terminal hydrolase BAP1
Organism
Xenopus laevis
Length
618 amino acids
Function
Deubiquitinating enzyme that plays a key role in chromatin by mediating deubiquitination of histone H2A. Catalytic component of the PR-DUB complex, a complex that specifically mediates deubiquitination of histone H2A monoubiquitinated at 'Lys-119' (H2AK119ub1) (By similarity).
Similarity
Belongs to the peptidase C12 family. BAP1 subfamily.
Mass
68.256 kDa
Sequence
MNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCPGPVYGFIFLFKWIEERRSRRKVSTLLDDTSVMEDEVVNNMFFAHQLIPNSCATHALLSVLLNCGGVHLGPTLSRIKEFTKGFSPESKGYAIGNAPELAKAHNSHARPEPRHLPEKQNGISAVRTMEAFHFVSYVPIKGRLFELDGLKVYPIDHGPWAEDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRLKYEGKLNILKMNRQTVLEALQQLIRVTQPELIQAQKSTDGQSTEETKSPAIKAPVSQESHRAHHGSHRSTTDLGAEPAGSLLRGPVLSAHNKSKPLPQNGGIVPAPASRLPAFLDNHNYAKSPMQEEEDLAAGVGRSRGVPPPAPDTDEEEEEETENVRRPLTPPGFKRRSSESLPPPPGPEPGVLAEKLKETQRDLCSPLSIKTGAPTAPHSQPSPTPSNESTDTASEIGSAFNSPLRSPLRSANPTRPSSPVTSHLSKVLFGEEEPLSRLDCVRYNRAVRELGPHISTGILHLSKDGYLSPLSRLDTGKVSPKSHKAEEPRESPEPDSERNRVTEAPQGEKFSPKELLALLKCVEAEISASEACLREELEKRKKIQD

Gene
BAP1
Protein
BON1-associated protein 1
Organism
Arabidopsis thaliana
Length
192 amino acids
Function
Negative regulator of cell death and defense responses. Exhibits calcium-dependent phospholipid binding properties.
Mass
21.992 kDa
Sequence
MIYFGRSIDNHYTTMMTKTLEIDLRSAEGLKLNRRPIKKKTFAVVKIDEKCRKSNLDESRRSNPTWNYKSEMPINGNEQFIFIEVFYRTGSGHDKKIGEAKIPTNDFMGRYSPEGHLNFLSYRLRDEFGDKCGIVNLSILVKSDPTRDYGACSSQAAVTGLWRPRLETASIDGYGGRTVTGVPVWGLYQRQF