About Services Plasmids Contact

Avin_03250

Gene
Avin_03250
Protein
UPF0312 protein Avin_03250
Organism
Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Length
192 amino acids
Similarity
Belongs to the UPF0312 family. Type 1 subfamily.
Mass
20.596 kDa
Sequence
MLKKTLAALALGSALLGAGQAMAADYVIDKEGQHAFVNFKISHLGYSWLYGTFRDFDGSFSFDAAKPEASKVKVNLKTASVDSNHAERDKHIRSADFLNVAKHPTATFESTGVKSTGQDTFDITGNLSLNGVTKPVVIAARFIGEGKDPWGGYRAGFEGGTKLKLKDFGIQKDLGPASQEVDLIISVEGVRQ