About Services Plasmids Contact

Avi_2676

Gene
Avi_2676
Protein
Deoxyguanosinetriphosphate triphosphohydrolase-like protein
Organism
Agrobacterium vitis (strain S4 / ATCC BAA-846)
Length
405 amino acids
Similarity
Belongs to the dGTPase family. Type 2 subfamily.
Mass
45.914 kDa
Sequence
MTIDRNALGFGVGERAIFAADPWNSRGRLYPEGGSLTRSDFQRDRDRIVHTTAFRRLKHKTQVFIGPDSDHYRTRLTHTIEVAQIARALARAFRIDEDLAEGVALVHDFGHTPFGHTGEDALHELLEPYGGFDHNAQSLRIVTKLERRYAEFDGLNLTWETLEGLVKHNGPLMNADGEGTRGPVPLPITEYCQMQDLDIASHASLEAQAAAVADDIAYNTHDIDDGLRSGYLTFDMLEDVPFLAGLMRDVRDRYPNLEADRFTHEIMRRQITRMVEDVIAVAQERLARIRPMSADDIRQAGETVITFSEGMAETDRQIKKLLFSKIYRHPDIMRIRAGAAQIVTDLFKAYMADPTLMRSDYWVEHTAGLETPAKARHVGDFLAGMTDTYAVRVHRQLFDHTPDLR