Avh6

RxLR effector protein Avh6

125 amino acids

Effector that suppresses plant defense responses during the early stages of pathogen infection. Suppresses cell death induced by effectors and PAMPs in plant hosts (PubMed:21653195, PubMed:23550527). Triggers a hypersensitive response (HR) in the presence of Rps1d (PubMed:23550527, PubMed:23594349). Suppresses BAX-induced cell death and enhanced P.capsici infection in Nicotiana benthamiana. Also suppresses effector-triggered immunity induction by associating with Avr1b and Rps1b, suggesting a role in suppressing plant immunity (PubMed:23594349).

Belongs to the RxLR effector family.

13.904 kDa

MRLSSTTFVVLAAVLLASGTAVSKADETGVTNVNAVHSPNVLAGVDKRFLRSHHTEDGKAKLSNYDNEERNGLFAAGTLSDMANDMIFRFKMFTKWKANGHLPKAIKKDIPRSLYKAYKIHHRMN

Avh6

RxLR effector protein Avh6

125 amino acids

Effector that suppresses plant defense responses during the early stages of pathogen infection. Suppresses cell death induced by effectors and PAMPs in plant hosts (PubMed:23550527). Triggers a hypersensitive response (HR) in the presence of Rps1d (PubMed:23550527, PubMed:23594349). Suppresses BAX-induced cell death and enhan,ced P.capsici infection in Nicotiana benthamiana. Also suppresses effector-triggered immunity induction by associating with Avr1b and Rps1b, suggesting a role in suppressing plant immunity (PubMed:23594349).

Belongs to the RxLR effector family.

13.979 kDa

MRLSSTTFVVLAAVLLASGTAVSKADETGVTNVNAVHSPNVLAGVDKRFLRSHHTEDGEAKLSNYDNEERNGLFGANTLSNMGKDTILRFQMFTKWKANGYLPKKIKDDIPRSLYKAYKIHYRMN