About Services Plasmids Contact

Avh238

Gene
Avh238
Protein
RxLR effector protein Avh238
Organism
Phytophthora sojae
Length
134 amino acids
Function
Effector that, due to the lack of a histidine residue at position 79, is not able to induce cell death in tomato, tobacco, eggplant, potato, or in A.thaliana.
Similarity
Belongs to the RxLR effector family.
Mass
14.1 kDa
Sequence
MRGVFFVAVAVAIFARSSAEAKLLSEAAPGLAADAVISGESRERFLRVADSEDDDLAAPADDGKTEERAPKFKSLSEINKKLDEEVMVHVSKILGNMGAIHADNIAKARAALEAAHKSGDITDKQLAAGLAKLV

Gene
Avh238
Protein
RxLR effector protein Avh238
Organism
Phytophthora sojae (strain P6497)
Length
134 amino acids
Function
Effector that suppresses plant defense responses during the early stages of pathogen infection. Suppresses cell death induced by effectors and PAMPs in plant hosts (PubMed:21653195). Is able to induced cell death in tomato, tobacco, eggplant, and potato, but not in A.thaliana (PubMed:28134441). Interacts with and destabilizes host 1-aminocyclopropane-1-carboxylate synthases. By suppressing type2 ACS-catalyzed ethylene biosynthesis, Avh238 facilitates Phytophthora infection (PubMed:30394556).
Similarity
Belongs to the RxLR effector family.
Mass
14.074 kDa
Sequence
MRGVFFVAVAVAIFARSSAEAKLLSEAAPGLAADAVISGESRERFLRVADPEDDDLAAPADDGKTEERAPKFKSLNEIHKKLDEEDMVHVSKILGNMGAIHADNIAKARAALKAAHESGATTANQLVAGLAKPV