Avh238

RxLR effector protein Avh238

134 amino acids

Effector that, due to the lack of a histidine residue at position 79, is not able to induce cell death in tomato, tobacco, eggplant, potato, or in A.thaliana.

Belongs to the RxLR effector family.

14.1 kDa

MRGVFFVAVAVAIFARSSAEAKLLSEAAPGLAADAVISGESRERFLRVADSEDDDLAAPADDGKTEERAPKFKSLSEINKKLDEEVMVHVSKILGNMGAIHADNIAKARAALEAAHKSGDITDKQLAAGLAKLV

Avh238

RxLR effector protein Avh238

134 amino acids

Effector that suppresses plant defense responses during the early stages of pathogen infection. Suppresses cell death induced by effectors and PAMPs in plant hosts (PubMed:21653195). Is able to induced cell death in tomato, tobacco, eggplant, and potato, but not in A.thaliana (PubMed:28134441). Interacts with and destabilizes host 1-aminocyclopropane-1-carboxylate synthases. By suppressing type2 ACS-catalyzed ethylene biosynthesis, Avh238 facilitates Phytophthora infection (PubMed:30394556).

Belongs to the RxLR effector family.

14.074 kDa

MRGVFFVAVAVAIFARSSAEAKLLSEAAPGLAADAVISGESRERFLRVADPEDDDLAAPADDGKTEERAPKFKSLNEIHKKLDEEDMVHVSKILGNMGAIHADNIAKARAALKAAHESGATTANQLVAGLAKPV