About Services Plasmids Contact

Ava_4254

Gene
Ava_4254
Protein
UPF0437 protein Ava_4254
Organism
Anabaena variabilis (strain ATCC 29413 / PCC 7937)
Length
86 amino acids
Similarity
Belongs to the UPF0437 family.
Mass
9.805 kDa
Sequence
MRSIMVQSAKTDSVNQQTIEGLKLQIKKLNSKAGQLKMDLHDLAEGLPIDYQNLTALAAETYEIYRHLDELKSQLKSLEKNHDMGY