About Services Plasmids Contact

Ava_4222

Gene
Ava_4222
Protein
Putative membrane protein insertion efficiency factor
Organism
Anabaena variabilis (strain ATCC 29413 / PCC 7937)
Length
82 amino acids
Function
Could be involved in insertion of integral membrane proteins into the membrane.
Similarity
Belongs to the UPF0161 family.
Mass
9.555 kDa
Sequence
MKQIFIWLIKGYRMFISPLFPPTCRFQPTCSMYALEAIERFGVFRGGWMGIRRILRCHPFHPGGYDPVPEVGEHCCHHDSGK