About Services Plasmids Contact

Ava_2513

Gene
Ava_2513
Protein
UPF0367 protein Ava_2513
Organism
Anabaena variabilis (strain ATCC 29413 / PCC 7937)
Length
90 amino acids
Similarity
Belongs to the UPF0367 family.
Mass
9.614 kDa
Sequence
MFTIDLSIKNTAFPITVQRKTAEDAEAVYQLILAAIRSGNPDIVELKCEGKTEKKIAVRASEISGVQITQKDGVTTSSGRAPGFFALAGE