About Services Plasmids Contact

Atu8092

Gene
Atu8092
Protein
UPF0314 protein Atu8092
Organism
Agrobacterium fabrum (strain C58 / ATCC 33970)
Length
198 amino acids
Similarity
Belongs to the UPF0314 family.
Mass
22.573 kDa
Sequence
MTVAEMSASRSRSLRWFGVAAGLLLLQIVILYAMGRIPICECGYVKLFEPGVNTPGNSQHLADWYTPSHIIHGFLFYWFAWLLFRNKPFSMRLSFAVLIEAAWELLENSPIIIDRYRTATTALGYTGDSILNSAMDTVFMALGFLFAARVPVWLTVVIAIFFEIFTGWLIRDNLTLNVVMLVWPVDVIKEWQNALPQM