About Services Plasmids Contact

Atu4601

Gene
Atu4601
Protein
Insertion element IS136 uncharacterized protein Atu4601
Organism
Agrobacterium fabrum (strain C58 / ATCC 33970)
Length
195 amino acids
Mass
21.864 kDa
Sequence
MGNHAMLLEKHTAVRKGRLHDGKVMVMRSNLRWCSDGLEFACWNGEVIRLAFIIDAFDREIIAWTAVANAGISGSDVRDMMLEAVEKRFHATRAPHAIEHLSDNGSAYTARDTRLFAQALNLTPCFTPVASPQSNGMSEAFVKTLKRDYIRISALPDAQTALRLIDGWIEDYNEIHPHSALKMASPRQFIRAKSI