About Services Plasmids Contact

Atu3818

Gene
Atu3818
Protein
Putative ribose/galactose/methyl galactoside import ATP-binding protein 3
Organism
Agrobacterium fabrum (strain C58 / ATCC 33970)
Length
499 amino acids
Function
Part of an ABC transporter complex involved in carbohydrate import. Could be involved in ribose, galactose and/or methyl galactoside import. Responsible for energy coupling to the transport system.
Similarity
Belongs to the ABC transporter superfamily. Carbohydrate importer 2 (CUT2) (TC 3.A.1.2) family.
Mass
53.477 kDa
Sequence
MTATASALRMRGISKIFPGVKALSNVNFTVEYGRIHAVVGENGAGKSTLMKILSGSYAPTTGTTEIAGVEVQMRRPADAQKLGIRMVHQELNLVPDLTVAENIYLGRMPHRRFLVDRQAMLRKAAAVLKELEAAIDPKARLGDLPISQQQLVEIAKSYSADPRIIVLDEPTSSLSEHETTALFSILRKMKSQGIAIIYISHRLKEVLDIADDVTILRDGSMIDTRPAAGITAAEMIRLMVGREVANVFPKTPSKIGPVAFKVTGLSDGEKFHDVGFDVRSGEILGLTGLVGAGRTEVAQAIFGLAPLATGRIEINGKAVTIGSPAAAVKAGVAYVPEDRKGDGIVPSMSVRENISLPVLRRLSRLGRIGMSRDRGLAAKYTRDFSIVPPDPERRINLLSGGNQQKAIISRWLAAGPKVLILDEPTRGVDVGAKAEIHRIIGELVAGGMAVVMISSELPEVMGVCDRVVVMRDGRASSPIARGDLTEERIMALATGEEPA