About Services Plasmids Contact

Atu3696

Gene
Atu3696
Protein
UPF0434 protein Atu3696
Organism
Agrobacterium fabrum (strain C58 / ATCC 33970)
Length
62 amino acids
Similarity
Belongs to the UPF0434 family.
Mass
7.113 kDa
Sequence
MDDRMSNVDPKLLELLVCPLTKGRLSYDRTHNELISESARLAYPIRDGVPIMLISEARKIEE