About Services Plasmids Contact

Atu3163

Gene
Atu3163
Protein
D-altritol 5-dehydrogenase
Organism
Agrobacterium fabrum (strain C58 / ATCC 33970)
Length
336 amino acids
Function
Involved in D-altritol catabolism. Catalyzes the oxidation of D-altritol to D-tagatose.
Similarity
Belongs to the zinc-containing alcohol dehydrogenase family.
Mass
35.186 kDa
Sequence
MHAIQFVEKGRAVLAELPVADLPPGHALVRVKASGLCHTDIDVLHARYGDGAFPVIPGHEYAGEVAAVASDVTVFKAGDRVVVDPNLPCGTCASCRKGLTNLCSTLKAYGVSHNGGFAEFSVVRADHLHGIGSMPYHVAALAEPLACVVNGMQSAGIGESGVVPENALVFGAGPIGLLLALSLKSRGIATVTMADINESRLAFAQDLGLQTAVSGSEALSRQRKEFDFVADATGIAPVAEAMIPLVADGGTALFFGVCAPDARISVAPFEIFRRQLKLVGSHSLNRNIPQALAILETDGEVMARLVSHRLPLSEMLPFFTKKPSDPATMKVQFAAE