About Services Plasmids Contact

Atu3128

Gene
Atu3128
Protein
Protein Atu3128
Organism
Agrobacterium fabrum (strain C58 / ATCC 33970)
Length
233 amino acids
Function
Seems to regulate the surface properties of the bacterium in the presence of plant cells or plant cell extracts. Mutations in this protein are responsible for an increased aggregation of the bacteria in the presence of pea root cap cells (By similarity).
Similarity
Belongs to the glycosyl hydrolase 88 family.
Mass
24.935 kDa
Sequence
MGLPFQIEYGQTTGRPELIEDALRQFSAALALTADAGGLYVHGYDESRNQRWANPASGKSPAIWARAVGWLAMALVDALVILPDDSATAELRERTRRLLAGIIARQTQAGLWMQVLDNQGLAGNYAETSASAMFAYALLRAARLGLLRGEEAKAALSAGRQALAALLETRLELDEQGVARLTGIVHVAGLGGFDGNYRDGTPDYYLTEPVVSDDAKGVGPLMMAYAESLLLAR