About Services Plasmids Contact

Atu2676

Gene
Atu2676
Protein
Putative pterin-4-alpha-carbinolamine dehydratase
Organism
Agrobacterium fabrum (strain C58 / ATCC 33970)
Length
101 amino acids
Similarity
Belongs to the pterin-4-alpha-carbinolamine dehydratase family.
Mass
11.247 kDa
Sequence
MKYPRLEPDAIRQALSKLEGWSLREDGAAIVRSFKFSSFAEAFGFMAESALAAEKLNHHPEWSNVYSRVKVCLTTHDSQGVTERDFLLAEAMQKAAAGRGN