About Services Plasmids Contact

Atu1728

Gene
Atu1728
Protein
NAD(P)H dehydrogenase (quinone)
Organism
Agrobacterium fabrum (strain C58 / ATCC 33970)
Length
199 amino acids
Similarity
Belongs to the WrbA family.
Mass
20.933 kDa
Sequence
MTKVLVLYYSSYGHIETMAYAVAEGVESTGAEAVVKRVPELVPEEVAKSSHFKMDQPAPVATVDELAEYDAIIVGAGTRFGTVASQMRNFWDQTGGLWFSGKLVGKVGSAFTSSATQHGGQESTILGFIPTFLHHGMAVVGLPYAFQGQMGVDEIKGGSPYGASTITDGDGSRQPSAIELDAARYQGAHVAKLAAKLSA