About Services Proteins Contact

AtMg00010

Gene
AtMg00010
Protein
Uncharacterized mitochondrial protein AtMg00010
Organism
Arabidopsis thaliana
Length
153 amino acids
Mass
16.759 kDa
Sequence
MSLLFQQTVPLSHLHRSLDPPLCFRTHILLILLLLSRHLPGFTGSDCESADPSIVSAIAPGTATTSERDCPVRTAGSDPVPIGDSGTFFDVGTAAPELLSPNRHHMITRAKDGIRKPNPRYNLFTQKYTPSEPKTITSASQDGDKLCKKRCRH