About Services Proteins Contact

At1g33607

Gene
At1g33607
Protein
Putative defensin-like protein 26
Organism
Arabidopsis thaliana
Length
81 amino acids
Similarity
Belongs to the DEFL family.
Mass
8.939 kDa
Sequence
MASLKVFSFALLIVLTFSVIGMIYNVESGGSLCCNSHPKFGKCNTNNDEQRCNRWCHNGCGNGKGGYYKSMSHGGQCHYYC