Antp

Homeotic protein antennapedia

394 amino acids

Sequence-specific transcription factor which is part of a developmental regulatory system that regulates segmental identity in the mesothorax. Provides cells with specific positional identities on the anterior-posterior axis (By similarity).

Belongs to the Antp homeobox family.

44.55 kDa

MTMSTNNCESMTSYFTNSYMGADMHHGHYPGNGVTDLDAQQMHHYSQNPNHQGNMPYPRFPPYDRMPYYNGQGMDQQQQQHQGYSRPDSPSSQVGGVMPQAQTNGLPTGGQLVAQQQQQQPQQQSQTPQQQQAQQPQQQQQQLQQLPQVTQQVTHPQQQQQQQQQQQQPVVYASCKLQAAVGVGLGMVPEGGSPPLVDQMTGHHMNAQMSLPHHMGHPQAQLGYTDVGVPDVTEVHQNHHNMGMYGQQQTGVPPVGAPPQAMMHQGQGPPQMHQGHLPGQHTPPSQNPNSQSSGMPSPLYPWMRSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKGEPGSGGEGDEITPPNSPQ

Antp

Homeotic protein antennapedia

378 amino acids

Sequence-specific transcription factor which is part of a developmental regulatory system that regulates segmental identity in the mesothorax. Provides cells with specific positional identities on the anterior-posterior axis.

Belongs to the Antp homeobox family.

42.76 kDa

MTMSTNNCESMTSYFTNSYMGADMHHGHYPGNGVTDLDAQQMHHYSQNANHQGNMPYPRFPPYDRMPYYNGQGMDQQQQHQVYSRPDSPSSQVGGVMPQAQTNGQLGVPQQQQQQQQQPSQNQQQQQAQQAPQQLQQQLPQVTQQVTHPQQQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHHMGHPQAQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPVGAPPQGMMHQGQGPPQMHQGHPGQHTPPSQNPNSQSSGMPSPLYPWMRSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKGEPGSGGEGDEITPPNSPQ