About Services Proteins Contact

Aflv_1588

Gene
Aflv_1588
Protein
UPF0145 protein Aflv_1588
Organism
Anoxybacillus flavithermus (strain DSM 21510 / WK1)
Length
105 amino acids
Similarity
Belongs to the UPF0145 family.
Mass
11.272 kDa
Sequence
MIVTTTNSIEGKQIEQYLGLVSGEVILGANVVRDFLASITDIIGGRSGTYESKLAEGREMAVQEMVKKARNMGANAVIGVDLDFETLRDGMMMCIATGTAVKLKE