About Services Plasmids Contact

AVPI1

Gene
AVPI1
Protein
Arginine vasopressin-induced protein 1
Organism
Homo sapiens
Length
147 amino acids
Function
May be involved in MAP kinase activation, epithelial sodium channel (ENaC) down-regulation and cell cycling.
Mass
16.773 kDa
Sequence
MGTPASVVSEPPPWQAPIEARGRKQASANIFQDAELLQIQALFQRSGDQLAEERAQIIWECAGDHRVAEALKRLRRKRPPRQKPLGHSLHHCSRLRILEPHSALANPQSATETASSEQYLHSRKKSARIRRNWRKSGPTSYLHQIRH

Gene
AVPI1
Protein
Arginine vasopressin-induced protein 1
Organism
Pongo abelii
Length
147 amino acids
Function
May be involved in MAP kinase activation, epithelial sodium channel (ENaC) down-regulation and cell cycling.
Mass
16.779 kDa
Sequence
MGTPASVVSEPPPWQAPTEARGRKQASANIFQDAELLQIQGLFQRSGDQLAEERAQIIWECAGDHHVAEALKRLRRKRPPRQKPLGHSLHHCSRLRILEPHSPLADPQSATETASTEQYLHSRRKSARIRRNWKKPGPTSYLHQIRH

Gene
Avpi1
Protein
Arginine vasopressin-induced protein 1
Organism
Rattus norvegicus
Length
146 amino acids
Function
May be involved in MAP kinase activation, epithelial sodium channel (ENaC) down-regulation and cell cycling.
Mass
16.412 kDa
Sequence
MGTPASVVSEPPLWQVSTAQPRDRGRGRKQASANIFQDAELVQIQGLFQRSGDQLAEERAQIIWECAGDHRVAEALRRLRRKRPPRQNHCSRLRVPELGSTAADPQASTTDTASSEQFGNSRRTSARVHRNWNKPGPTGYLHQIRH

Gene
AVPI1
Protein
Arginine vasopressin-induced protein 1
Organism
Bos taurus
Length
144 amino acids
Function
May be involved in MAP kinase activation, epithelial sodium channel (ENaC) down-regulation and cell cycling.
Mass
16.315 kDa
Sequence
MGTPASVVSEPPPWRAPPEVRGRKQAAANIFQDAELLQIQGLFQRSGDQLAEERAQIVWECAGDHRVAEALKRLRRKRPPRQKPLGPSVHHCSRLRTAEPCAPQSRATETASSEQHVNSRRASARIRRNWRKPGPTSYLHQIRH

Gene
Avpi1
Protein
Arginine vasopressin-induced protein 1
Organism
Mus musculus
Length
142 amino acids
Function
May be involved in MAP kinase activation, epithelial sodium channel (ENaC) down-regulation and cell cycling.
Mass
15.802 kDa
Sequence
MGTPASVVSEPPLWQVSTPQTRGRKQASANIFQDAELVQIQGLFQRSGDQLAEERAQIIWECAGDHRVAEALRRLRRKRPPKQNHCSRLRVPEPGSTASDPQASTTDTASSEQSGNSRRTSARAPRNWNKPGPTGYLHQIRH