About Services Plasmids Contact

AVNLA

Gene
AVNLA
Protein
Avenin-like a1
Organism
Triticum aestivum
Length
168 amino acids
Function
Seed storage protein. Not integrated in the gluten polymer through disulfide bonds, unless incorporated by reduction and reoxidation during dough making. Increases dough strength and bread volume, but decreases dough stability when added into a base wheat flour (By similarity).
Similarity
Belongs to the prolamin family.
Mass
18.427 kDa
Sequence
MKTMFLLALLAFTATSAVAQLYTTCSQGYGQCQQQPQPQPQPQPQMNTCAAFLQQCSQTPHVQTQMWQASGCQLVRQQCCQPLAQISEQARCQAVCSVAQIIMRQQQGQSFGQPQQQVPVEIMRMVLQTLPLMCRVNIPQYCTTTPCSTITPAIYSIPMTATCAGGAC