About Services Plasmids Contact

AVD

Gene
AVD
Protein
Avidin
Organism
Gallus gallus
Length
152 amino acids
Function
The biological function of avidin is not known. Forms a strong non-covalent specific complex with biotin (one molecule of biotin per subunit of avidin).
Similarity
Belongs to the avidin/streptavidin family.
Mass
16.768 kDa
Sequence
MVHATSPLLLLLLLSLALVAPGLSARKCSLTGKWTNDLGSNMTIGAVNSRGEFTGTYITAVTATSNEIKESPLHGTQNTINKRTQPTFGFTVNWKFSESTTVFTGQCFIDRNGKEVLKTMWLLRSSVNDIGDDWKATRVGINIFTRLRTQKE