About Services Plasmids Contact

AURKAIP1

Gene
Aurkaip1
Protein
Aurora kinase A-interacting protein
Organism
Mus musculus
Length
200 amino acids
Function
May act as a negative regulator of Aurora-A kinase, by down-regulation through proteasome-dependent degradation.
Similarity
Belongs to the mitochondrion-specific ribosomal protein mS38 family.
Mass
23.3 kDa
Sequence
MFLARLTSRLARTVVPWAGFSRSCPGSGVIGSYAFRPLYSLQPASPSRAASLPGKRTQSELEEFLVPRKMAISPLESWLTAQYLLPRRNVEVPVTLAPSQFYECPPRQGEEEAQQGVREAWDATPVQCKNVLKIRRRKMNHHKYRKLVKRTRFLRRKVREGRLKKKQIKFEKDLKRIWLKAGLKEAPENWQTPKIYLKNK

Gene
AURKAIP1
Protein
Aurora kinase A-interacting protein
Organism
Homo sapiens
Length
199 amino acids
Function
May act as a negative regulator of Aurora-A kinase, by down-regulation through proteasome-dependent degradation.
Similarity
Belongs to the mitochondrion-specific ribosomal protein mS38 family.
Mass
22.354 kDa
Sequence
MLLGRLTSQLLRAVPWAGGRPPWPVSGVLGSRVCGPLYSTSPAGPGRAASLPRKGAQLELEEMLVPRKMSVSPLESWLTARCFLPRLDTGTAGTVAPPQSYQCPPSQIGEGAEQGDEGVADAPQIQCKNVLKIRRRKMNHHKYRKLVKKTRFLRRKVQEGRLRRKQIKFEKDLRRIWLKAGLKEAPEGWQTPKIYLRGK