About Services Plasmids Contact

ATX1

Gene
ATX1
Protein
Histone-lysine N-methyltransferase ATX1
Organism
Arabidopsis thaliana
Length
1062 amino acids
Function
Histone methyltransferase. Methylates 'Lys-4' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. Required to maintain the active state of class A (AP1 and AP2), class B (PI and AP3) and class C (AG) floral homeotic genes at early stages of flower development. Regulates floral organ identity and flowering transition. Functions as a receptor for the lipid messenger phosphatidylinositol 5-phosphate (PI5P), which regulates negatively its transcriptional activation activity.
Similarity
Belongs to the class V-like SAM-binding methyltransferase superfamily. Histone-lysine methyltransferase family. TRX/MLL subfamily.
Mass
119.711 kDa
Sequence
MACFSNETQIEIDVHDLVEAPIRYDSIESIYSIPSSALCCVNAVGSHSLMSKKVKAQKLPMIEQFEIEGSGVSASDDCCRSDDYKLRIQRPEIVRVYYRRRKRPLRECLLDQAVAVKTESVELDEIDCFEEKKRRKIGNCELVKSGMESIGLRRCKENNAFSGNKQNGSSRRKGSSSKNQDKATLASRSAKKWVRLSYDGVDPTSFIGLQCKVFWPLDALWYEGSIVGYSAERKRYTVKYRDGCDEDIVFDREMIKFLVSREEMELLHLKFCTSNVTVDGRDYDEMVVLAATLDECQDFEPGDIVWAKLAGHAMWPAVIVDESIIGERKGLNNKVSGGGSLLVQFFGTHDFARIKVKQAISFIKGLLSPSHLKCKQPRFEEGMQEAKMYLKAHRLPERMSQLQKGADSVDSDMANSTEEGNSGGDLLNDGEVWLRPTEHVDFRHIIGDLLIINLGKVVTDSQFFKDENHIWPEGYTAMRKFTSLTDHSASALYKMEVLRDAETKTHPLFIVTADSGEQFKGPTPSACWNKIYNRIKKVQNSDSPNILGEELNGSGTDMFGLSNPEVIKLVQDLSKSRPSSHVSMCKNSLGRHQNQPTGYRPVRVDWKDLDKCNVCHMDEEYENNLFLQCDKCRMMVHAKCYGELEPCDGALWLCNLCRPGAPDMPPRCCLCPVVGGAMKPTTDGRWAHLACAIWIPETCLSDVKKMEPIDGVNKVSKDRWKLMCTICGVSYGACIQCSNNSCRVAYHPLCARAAGLCVELENDMSVEGEEADQCIRMLSFCKRHRQTSTACLGSEDRIKSATHKTSEYLPPPNPSGCARTEPYNCFGRRGRKEPEALAAASSKRLFVENQPYVIGGYSRLEFSTYKSIHGSKVSQMNTPSNILSMAEKYRYMRETYRKRLAFGKSGIHGFGIFAKLPHRAGDMMIEYTGELVRPSIADKREQLIYNSMVGAGTYMFRIDDERVIDATRTGSIAHLINHSCVPNCYSRVITVNGDEHIIIFAKRHIPKWEELTYDYRFFSIGERLSCSCGFPGCRGVVNDTEAEEQHAKICVPRCDLIDWTAE

Gene
ATX1
Protein
Copper transport protein ATX1
Organism
Arabidopsis thaliana
Length
76 amino acids
Function
Plays an important role in copper homeostasis by conferring tolerance to excess of copper and subclinical copper deficiency during vegetative stage. Can complement the yeast mutants atx1 and sod1.
Similarity
Belongs to the ATX1 family.
Mass
8.158 kDa
Sequence
MSQTVVLRVAMTCEGCVGAVKRVLGKMEGVESFDVDIKEQKVTVKGNVQPDAVLQTVTKTGKKTAFWEAEGETAKA

Gene
ATX1
Protein
Metal homeostasis factor ATX1
Organism
Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Length
73 amino acids
Function
Shuttles copper to the transport ATPase CCC2. Protects against oxygen toxicity.
Similarity
Belongs to the ATX1 family.
Mass
8.221 kDa
Sequence
MAEIKHYQFNVVMTCSGCSGAVNKVLTKLEPDVSKIDISLEKQLVDVYTTLPYDFILEKIKKTGKEVRSGKQL

Gene
atx1
Protein
Metal homeostasis factor atx1
Organism
Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Length
68 amino acids
Function
Shuttles copper to the transport ATPase ccc2. Protects against oxygen toxicity (By similarity).
Similarity
Belongs to the ATX1 family.
Mass
7.662 kDa
Sequence
MKYQFNVAMACDGCKNAIDRVLTRLGVEDKSISVEKQEVIVTTDKPYELVEQTIKKTGKEVRSGKVLE