ATP6V1G3

V-type proton ATPase subunit G 3

118 amino acids

Catalytic subunit of the peripheral V1 complex of vacuolar ATPase (V-ATPase). V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.

Belongs to the V-ATPase G subunit family.

13.917 kDa

MTSQSQGIHQLLQAEKRAKDKLEEAKKRKGKRLKQAKEEAMVEIDQYRMQRDKEFRLKQSKIMGSQNNLSDEIEEQTLGKIQELNGHYNKYMESVMNQLLSMVCDMKPEIHVNYRATN

Atp6v1g3

V-type proton ATPase subunit G 3

118 amino acids

Catalytic subunit of the peripheral V1 complex of vacuolar ATPase (V-ATPase). V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.

Belongs to the V-ATPase G subunit family.

13.749 kDa

MTSQSQGIQQLLQAEKRAKDKLDEAKKRKGKRLRQAKEEAVAETDQYRMQMEKDFRLKQAKIMGSQSHLSDEIEEQTLEKIKELNGSYNKCMESVIKQLLSMVCDMKPEVHVNYRATN

atp6v1g3

V-type proton ATPase subunit G 3

118 amino acids

Catalytic subunit of the peripheral V1 complex of vacuolar ATPase (V-ATPase). V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells (By similarity).

Belongs to the V-ATPase G subunit family.

13.871 kDa

MASQSQGIQQLLQAEKRAKDKLEEAKKRKNKRLRQAKEEATADIDQYRLKREADFRRIQTSVMGSQGNLAVKIEEQTVEKIQFYSSSYNKYKEGVLKELLDLAYNIKPELHTNYKYKI

atp6v1g3

V-type proton ATPase subunit G 3

118 amino acids

Catalytic subunit of the peripheral V1 complex of vacuolar ATPase (V-ATPase). V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells (By similarity).

Belongs to the V-ATPase G subunit family.

13.813 kDa

MASQSQGIQQLLQAEKRAKDKLEEAKKRKNKRLRQAKEEATADIDQYRLKREGDFRRIQTSVMGSQGNLAVKIEEQTVEKIQLYSSSFHKYKEGVLQQLLDLAYNIKPELHTNFQYKL