Protein
ATG8-interacting protein 1
Organism
Arabidopsis thaliana
Function
Involved in a special stress-induced plastid-to-vacuole protein trafficking pathway. Interacts with ATG8F in plastid bodies to subsequently enable their delivery to the vacuole by an autophagic pathway. Interacts with the plastid proteins APE1 and PSBS/NPQ4 and may recruit them as cargo into plastid bodies that may be recognized by the autophagy machinery for degradation in the vacuole. Involved in the alleviation of damage caused by salt stress during plant development, probably through its involvement in plastid-to-vacuole and ER-to-vacuole trafficking (PubMed:25281689). Plays a role in seed germination in response to exogenous abscisic acid (ABA) treatment (PubMed:22253227).
Sequence
MANNEEHPPRGNEWEVVSLTSSAYAAAPGPYNVESRDVRKYDAYYGAETSRDLYMSEHFVFPPSEHENLPIDESLFVAEQRKDGRDLMLEGQGLSDQFHYEAGNNQQSIYGESALGSSRHMESFGSESAVYEHGLVDAEGNLDLHSDGEGEKDVKKSTHNLPCEAWWKRRAISMYSRTREANAIWSLFFAAAVTGLVVLGQRWQQERWQVLQLKWQSSISSEKLGRVLEPLSRLKDVIVRSNPQASLVRSGSSSEV