ATG3

Autophagy-related protein 3

366 amino acids

E2 conjugating enzyme required for the cytoplasm to vacuole transport (Cvt) and autophagy. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Responsible for the E2-like covalent binding of phosphatidylethanolamine to the C-terminal Gly of ATG8. The ATG12-ATG5 conjugate plays a role of an E3 and promotes the transfer of ATG8 from ATG3 to phosphatidylethanolamine (PE). This step is required for the membrane association of ATG8. The formation of the ATG8-phosphatidylethanolamine conjugate is essential for autophagy and for the cytoplasm to vacuole transport (Cvt). The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy (By similarity).

Belongs to the ATG3 family.

40.861 kDa

MEAHKGKQDIFIVQVLITPTFVELNHIYPPIRLLSPPSISSNPSIKFDKTQAPPTLFIYIASYNTPDYQTTLHKSTMLHVRAAASSLREYLTPVSNTSTFRTTGEITPDEFVKAGDYLVEKFPTWSWASASKSKVRDFLPPDKQVLVTRHVPSHVRASTVSGPVTLGEEEDGWTSFGVANTKDADGDDTEEIAEIADSDFEELDDDDDDAAEAPATATDHRTYNLYIAYSTSYRVPKMFLSGYSPEGSPLTPEDMFEDIIPEYRDKTVTIERPTFQDNITMVAIHPCKHANVMRVLMERVEAKGDKDITRGVAKLGVADADDGEGEEEWEEVENSAMRVDQYLVTFLKFIASVTPGIEHDYTMSAL

atg3

Autophagy-related protein 3

365 amino acids

E2 conjugating enzyme required for the cytoplasm to vacuole transport (Cvt) and autophagy. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Responsible for the E2-like covalent binding of phosphatidylethanolamine to the C-terminal Gly of atg8. The atg12-atg5 conjugate plays a role of an E3 and promotes the transfer of atg8 from atg3 to phosphatidylethanolamine (PE). This step is required for the membrane association of atg8. The formation of the atg8-phosphatidylethanolamine conjugate is essential for autophagy and for the cytoplasm to vacuole transport (Cvt). The atg8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy (By similarity).

Belongs to the ATG3 family.

40.659 kDa

MNILHSTLSTWRDRLAPVSRTSTFRTTGQITPEEFVLAGDYLVYKFPSWSWGDASSPSKRVSYLPPGKQFLVTRGVPCHRRLNENFAGDAHLDDEIVRDFLSGGAGDSDGGDDNDGWLRTGGGGKRHESTIRDVRTVDESGKEEAEVEEEEDIPDMEDDDDEEAIIREPAGTTSTTQPTRTYNLYITYSNFYRTPRLYLSGYLSPSEPLPPKLMMEDIVGDYKDKTVTLEDFPWFDGSLQMASVHPCRHASVMKTLLDRADAALKLRREKIKQTAASSSPQEKAKLAQPESGLEGLVDDIKGLSLGDAQKQCQGDKGQAGGDEWEVLQHDEEEEVAIRVDQYLVVFLKFIASVTPGIEHDFTMGV

atg3

Autophagy-related protein 3

363 amino acids

E2 conjugating enzyme required for the cytoplasm to vacuole transport (Cvt) and autophagy. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Responsible for the E2-like covalent binding of phosphatidylethanolamine to the C-terminal Gly of atg8. The atg12-atg5 conjugate plays a role of an E3 and promotes the transfer of atg8 from atg3 to phosphatidylethanolamine (PE). This step is required for the membrane association of atg8. The formation of the atg8-phosphatidylethanolamine conjugate is essential for autophagy and for the cytoplasm to vacuole transport (Cvt). The atg8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy (By similarity).

Belongs to the ATG3 family.

40.716 kDa

MNILHSTLSTWRDRLAPVSRTSTFRNTGQITPEEFVLAGDYLVYKFPTWSWADASSPAKRVSYLPDGKQFLVTRGVPCHRRLNDNFAGDAGLEDEIVRDFLSGGDGGEGTVADDGEDGWLRTGGGRDAGADHDKQEARIRDVRTVDESGNLGEQEEDDDIPDMEDEDDDEEAIIRETDDQSGTPSLRTYTLYITYSNFYRTPRLYLSGYLSPSEPLPPHLMMEDIVGDYKDKTVTLEDFPWFEGSVKMASVHPCRHASVMKTLLDRADAALKLRRDKLKQTQSRDEADRVLRAGGGLEGLVDETKNMSLGDSHHAQPGGDEWEMLQRDEEEQVAIRVDQYLVVFLKFIASVTPGIEHDFTMGV

ATG3

Autophagy-related protein 3

362 amino acids

E2 conjugating enzyme required for the cytoplasm to vacuole transport (Cvt) and autophagy. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Responsible for the E2-like covalent binding of phosphatidylethanolamine to the C-terminal Gly of ATG8. The ATG12-ATG5 conjugate plays a role of an E3 and promotes the transfer of ATG8 from ATG3 to phosphatidylethanolamine (PE). This step is required for the membrane association of ATG8. The formation of the ATG8-phosphatidylethanolamine conjugate is essential for autophagy and for the cytoplasm to vacuole transport (Cvt). The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy (By similarity).

Belongs to the ATG3 family.

41.274 kDa

MLRSKLSSLREYLTPINHNSNFLTTGEISPEEFVKAGDYLVYKFPTWQWASCPKDLQKLFLPTDKQVLVTRHVPSHQRANEYFEGEFEVEIDEKDRDLALGNESNLKNGENGENDDEAEYGWIRSGRSSSEKGTGEVLDPQRVEEVNDIDELIDETAEGEEEEEEGEEGEGEGNGNGADFHADDDADYDDLDIVQGSHSKLRRYDLYITYSTSYRVPKLYLVGFDANGIPLLPQQMFEDINSDYKDKTATIEQLPVAHNTTSVSIHPCKHSSVMRVLMKHQRARREHENVAENMKRLSIGSEDHKEAMNHIRRLSAGSKELAQKQEEPNDSEIKVDLYLVIFLKFIASVTPGIEYDYTMDAL

atg3

Autophagy-related protein 3

362 amino acids

E2 conjugating enzyme required for the cytoplasm to vacuole transport (Cvt) and autophagy. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Responsible for the E2-like covalent binding of phosphatidylethanolamine to the C-terminal Gly of atg8. The atg12-atg5 conjugate plays a role of an E3 and promotes the transfer of atg8 from atg3 to phosphatidylethanolamine (PE). This step is required for the membrane association of atg8. The formation of the atg8-phosphatidylethanolamine conjugate is essential for autophagy and for the cytoplasm to vacuole transport (Cvt). The atg8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy (By similarity).

Belongs to the ATG3 family.

40.579 kDa

MNFLHSTLDRLREFTPVSNTSTFRTNGQITPEEFVAAGDYLVFKFPTWSWADASPTSKRASYLPAGKQFLVTRGVPCHRRLDDDFAGEAGHDETVVGDGEDFRGTGHSPGDDEDGWLRTGGLAASQEARARDVRTVDESGEMGEREDDEDDIPDMEDEDDDDEAIIRDPKADNANSSRRTYTIYIAYTPYYRTPRLYLSGYLSSSQPLPPHLMMEDIVGDYKDKTVTLEDFPYFSNNIKMASIHPCKHASVMKTLLDRADAALKLRREKQKQGKTVPGAKDTGMEGLVDDFEKTKISDKKAMLEGLKAGGNGNDEWEVLQHDQDFASEEEEVAIRVDQYLVVFLKFMASVTPGIEHDFTMGV

atg3

Autophagy-related protein 3

353 amino acids

E2 conjugating enzyme required for the cytoplasm to vacuole transport (Cvt) and autophagy. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Responsible for the E2-like covalent binding of phosphatidylethanolamine to the C-terminal Gly of atg8. The atg12-atg5 conjugate plays a role of an E3 and promotes the transfer of atg8 from atg3 to phosphatidylethanolamine (PE). This step is required for the membrane association of atg8. The formation of the atg8-phosphatidylethanolamine conjugate is essential for autophagy and for the cytoplasm to vacuole transport (Cvt). The atg8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy (By similarity).

Belongs to the ATG3 family.

39.706 kDa

MNILHSTLSTWRDRLAPVSRTSTFRTTGQITPEEFVLAGDYLVYKFPTWAWADASSPAKRVSYLPPGKQFLVTRGVPCHRRLNENFAGDAGHEDEIVRDMLSGADADDGDGWLRTGGGRDLAEKQAERIKDVRTVDESGNMGEREDDEEDIPDMEDDDDDEEAIIREPAGKSTTQPIRTYNLYITYSNFYRTPRLYLSGYLSPSEPLPPHLMMEDIVGDYKDKTVTLEDFPWFDGGLKMASVHPCRHASVMKTLLDRADAALKIRRDKLKQAHSAAEANRINSERGLEGLVDETRGLSLNEQQGHAAGGDEWEVLQHDEEDQVAIRVDQYLVVFLKFIASVTPGIEHDFTMGV

ATG3

Autophagy-related protein 3

350 amino acids

E2 conjugating enzyme required for the cytoplasm to vacuole transport (Cvt) and autophagy. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Responsible for the E2-like covalent binding of phosphatidylethanolamine to the C-terminal Gly of ATG8. The ATG12-ATG5 conjugate plays a role of an E3 and promotes the transfer of ATG8 from ATG3 to phosphatidylethanolamine (PE). This step is required for the membrane association of ATG8. The formation of the ATG8-phosphatidylethanolamine conjugate is essential for autophagy and for the cytoplasm to vacuole transport (Cvt). The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy (By similarity) (PubMed:30776962). Plays a role in appressorium formation and pathogenicity (PubMed:30776962).

Belongs to the ATG3 family.

38.938 kDa

MNSLYSVVNTLRDRYAPVSHTSTFRQTGEITPEEFVAAGDYLVFKFPTWSWGDADSESRRASHLPPGKQFLVTRNVPCNRRLNENFAGDAGLEEAVVDDGDEFKGSKGDDDGWLRTGGLSSSQPLKAREVRTVDDAGNAGERAQPDDDDDIPDMEDEEDDEAIIRDTDASGQTSSRRTYTLYIMYSPYYRTPRLYLSGYGANGQPLPPHNMMEDIMGDYKDKTVTLEDFPFFANNIKMASVHPCKHAPVMKTLLDRADAALKLRREKLKTGDASGQQAGLEGLADEFNKLGVSGKGDASKIDKNDEWEDIQHDDVADQEVAIRVDQYLVVFLKFIASVTPGIEHDFTMGV

ATG3

Autophagy-related protein 3

350 amino acids

E2 conjugating enzyme required for the cytoplasm to vacuole transport (Cvt) and autophagy. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Responsible for the E2-like covalent binding of phosphatidylethanolamine to the C-terminal Gly of ATG8. The ATG12-ATG5 conjugate plays a role of an E3 and promotes the transfer of ATG8 from ATG3 to phosphatidylethanolamine (PE). This step is required for the membrane association of ATG8. The formation of the ATG8-phosphatidylethanolamine conjugate is essential for autophagy and for the cytoplasm to vacuole transport (Cvt). The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy (By similarity).

Belongs to the ATG3 family.

38.716 kDa

MAYNFVRSYIDTFRERTAAISHTSTFRETGQITPEEFVLAGDFLVFKFPSWQWGDASSAGKRVPYLPEGKQYLMTRGVPCHRRLDDNFAGEAGQDETIVGDGFAGSEGADDDGWLRTGGMAASQEAKVRDVRTVDESGNLGAAEEEDEIPDMEDMDDDEEAIIRDPQGGSSSTAPLRTYTLYICYSAHYRTPRLYLSGYGATSVPLKPQEMMEDIVGDYKDKTVTIEDFPFFEHALKTASVHPCKHASVMKVLLDRADAALKLRLAKLKAGKDIGKLDTGMEGLVDDTRLLKLSEQAKGKEGDEAKDDWEVLSEGGDDEVAIRVDQYLVVFLKFMASVTPGIEHDFTMGV

ATG3

Autophagy-related protein 3

349 amino acids

E2 conjugating enzyme required for the cytoplasm to vacuole transport (Cvt) and autophagy (By similarity). Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production (By similarity). Responsible for the E2-like covalent binding of phosphatidylethanolamine to the C-terminal Gly of ATG8 (By similarity). The ATG12-ATG5 conjugate plays a role of an E3 and promotes the transfer of ATG8 from ATG3 to phosphatidylethanolamine (PE) (By similarity). This step is required for the membrane association of ATG8 (By similarity). The formation of the ATG8-phosphatidylethanolamine conjugate is essential for autophagy and for the cytoplasm to vacuole transport (Cvt) (By similarity). The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy (By similarity). Autophagy is required for proper vegetative growth, asexual/sexual reproduction, and full virulence (PubMed:28894236). Autophagy is particularly involved in the biosynthesis of deoxynivalenol (DON), an important virulence determinant (PubMed:28894236).

Belongs to the ATG3 family.

39.046 kDa

MNFLYSTVNTLRDRYTPVSHKSTFRQTGQITPEEFVAAGDYLVYKFPTWSWGDADSPERRVSHLPPGKQFLVTRNVPCHRRLNDDFAGDAGHEEALVNDGDDFKGNAGDDEDGWLRTGGLASSQPLKVKEVRTVDDSGNVGDREVVEDDEIPDMEDEDDDEAIIRDSGADSKNSAHRTYTLYIMYSPYYRTPRLYLSGYLANGQPLPPTDMTEDIVGDYKDKTVTLEDFPFFANNIKMASVHPCKHASVMKTLLDRADAALRLRREKLRAGNASSSQAPSGMEGLVDEIGKLDVKGAQEAADKDEWEEVQEAEIDDQEVAIRVDQYLVVFLKFMASVTPGIEHDFTMGV

ATG3

Autophagy-related protein 3

346 amino acids

E2 conjugating enzyme required for the cytoplasm to vacuole transport (Cvt) and autophagy (By similarity). Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production (By similarity). Responsible for the E2-like covalent binding of phosphatidylethanolamine to the C-terminal Gly of ATG8 (By similarity). The ATG12-ATG5 conjugate plays a role of an E3 and promotes the transfer of ATG8 from ATG3 to phosphatidylethanolamine (PE) (By similarity). This step is required for the membrane association of ATG8 (By similarity). The formation of the ATG8-phosphatidylethanolamine conjugate is essential for autophagy and for the cytoplasm to vacuole transport (Cvt) (By similarity). The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy (By similarity).

Belongs to the ATG3 family.

38.373 kDa

MNFLRSTAATLLDKYTPVSHTSTFRNTGQITPEEFVAAGDYLTFKFPSWSWADADSPSKRLTFLPAGKQFLVTRHVPCHRRLNNDFAGDAGHEEALVEGNKGGDDDDGWLRTGSMTSSQPLRVREVRNIDDAGNVGDREVVDEDDIPDMEDDDDDEAIIRAEGDNSNSGKRTYTLYITYANAYKCPRMYMSGYLANGQPLPPHLMMEDIVGDYKDKTVTLEDFPFFSHSVKMASVHPCRHASVMKTLLDRADAALKLRREKMKAGQGSGSEQGMEGLVDEINKLDVSGAHANAVEAAPGEDAEWEEVPHDVTDQEVAIRVDQYLVVFLKFIASVTPGIEHDFTMGV

ATG3

Autophagy-related protein 3

339 amino acids

E2 conjugating enzyme required for the cytoplasm to vacuole transport (Cvt) and autophagy. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Responsible for the E2-like covalent binding of phosphatidylethanolamine to the C-terminal Gly of ATG8. The ATG12-ATG5 conjugate plays a role of an E3 and promotes the transfer of ATG8 from ATG3 to phosphatidylethanolamine (PE). This step is required for the membrane association of ATG8. The formation of the ATG8-phosphatidylethanolamine conjugate is essential for autophagy and for the cytoplasm to vacuole transport (Cvt). The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy (By similarity).

Belongs to the ATG3 family.

38.371 kDa

MTGLYLRSTFSSLREYLTPISHKSTFTDTGEITPEEFVAAGDYLVYKFPTWQWSPAPESKKRDFLPNDKQFLVTRHVPSYVRAADYEHTEKEAEMMEEEDGWTSTNVDSVAPQRCNTEDERRHSIKYIEMTESGASSPEEGLAQHEGSGKHEINDIDELIDETAEESDLANDAGQGGIINDPKKRNYDLYITYSTSYRVPKMYLVGFNSNGVPLSPNEMFEDIASDYRQKTVTIEKAPFLSNTTSVSIHPCRHANVMRVLMKRAAHAAQAKKIRDKDLVTGVAKLGLADGKNADEEDDWENVEQGEEGIIRVDQYLVIFLKFIASVTPGIEYDYTMDAF

atg3

Autophagy-related protein 3

338 amino acids

E2 conjugating enzyme required for the cytoplasm to vacuole transport (Cvt), and autophagy. Responsible for the E2-like covalent binding of phosphatidylethanolamine to the C-terminal Gly of atg8. The atg12-atg5 conjugate plays a role of an E3 and promotes the transfer of atg8 from atg3 to phosphatidylethanolamine (PE). This step is required for the membrane association of atg8. The formation of the atg8-phosphatidylethanolamine conjugates is essential for autophagy and for the cytoplasm to vacuole transport (Cvt) (By similarity).

Belongs to the ATG3 family.

38.817 kDa

MLTSFQQAVHKAYVKTVEKVTPTLSTSKFLEEGVLTPEEFVQAGDLLTDKCQTWTWESGDPSRNVSYLPKEKQFLLTRNVPCYNRVRTLENESKASKADEIQIEDDGEDSWVAPQPVGNQDDIEDEKVDISSLKIDDKKPNTTTTTTAKPTNNNNNNNDDEDEDEDGDIPDLDDFQDDNIIEEEDPAVLSKNNKTTTTTTANNNNNNNSENKVEDNDNILRTRTYDISITYDKYYQTPRVWLFGYDENRKPLKPEEIFEDISEDHAHKTVTIDSHPHLGISFAYIHPCRHAAVMKKLVDRQSENGKEPRVDQYLFLFLKFISVVIPTIEYDFTLEFDT

ATG3

Autophagy-related protein 3

318 amino acids

E2 conjugating enzyme required for the cytoplasm to vacuole transport (Cvt) and autophagy. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Responsible for the E2-like covalent binding of phosphatidylethanolamine to the C-terminal Gly of ATG8. The ATG12-ATG5 conjugate plays a role of an E3 and promotes the transfer of ATG8 from ATG3 to phosphatidylethanolamine (PE). This step is required for the membrane association of ATG8. The formation of the ATG8-phosphatidylethanolamine conjugate is essential for autophagy and for the cytoplasm to vacuole transport (Cvt). The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy (By similarity).

Belongs to the ATG3 family.

36.469 kDa

MLRSTLSSWREYLTPVSHKSTFLSSGQITPDEFVQAGDYLCHMFPTWEWNKAGNDVLFRNFLPEDKQFLVMRKVPCNVRAKQFVNIDDSASEAFVQGINDEDGSIENGWMIGGGETDHLSKHSLSSGDVTPSGNNTKTMDETTPDIDDLMESMGIEDTDDIIDTPQNTDRRYYDLYITYSTSYKVPKMYIVGFNGSGSPLTPEEMFEDIAPDYRSKTATIEKLPFYKNTISSVSIHPCKHANVMRILLDKVLVVKRRRREEMSENHNEHKPNPESDEWEDLQNDVDDTIRADQYLIIFLKFITSVTPGIEHDYTMEGW

ATG3

Autophagy-related protein 3

318 amino acids

E2 conjugating enzyme required for the cytoplasm to vacuole transport (Cvt) and autophagy. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Responsible for the E2-like covalent binding of phosphatidylethanolamine to the C-terminal Gly of ATG8. The ATG12-ATG5 conjugate plays a role of an E3 and promotes the transfer of ATG8 from ATG3 to phosphatidylethanolamine (PE). This step is required for the membrane association of ATG8. The formation of the ATG8-phosphatidylethanolamine conjugate is essential for autophagy and for the cytoplasm to vacuole transport (Cvt). The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy (By similarity).

Belongs to the ATG3 family.

35.978 kDa

MLRSKLSSLREYLTPINHNSNFSTTGEISPEEFVQAGDYLVYKFPTWQWSTCPKNLQKSFLPADKQFLITRHVPSYQRASNYLTGGNVDFDDDEEYEDDEEGDGWVKSRKVVSVTKPQDGQEEEPQEINDIDDLIDVTAEGAEDDGDNLEDFDDLDIRNDGGSVRKYDMYITYSTSYRVPKMYLVGFNANGIPLTPDQMFEDINADYKDKTATIENLPVAHNTTSVSIHPCKHSSVMKVLMKHSKSKKTREEVNHLSEELGKTNISDKSQEDTGKDAEAAAGPEAEDSIRVDQYLVIFLKFIASVTPGIEYDYTMDAL

ATG3

Ubiquitin-like-conjugating enzyme ATG3

314 amino acids

E2 conjugating enzyme required for the cytoplasm to vacuole transport (Cvt), autophagy, and mitochondrial homeostasis. Responsible for the E2-like covalent binding of phosphatidylethanolamine to the C-terminal Gly of ATG8-like proteins (GABARAP, GABARAPL1, GABARAPL2 or MAP1LC3A). The ATG12-ATG5 conjugate plays a role of an E3 and promotes the transfer of ATG8-like proteins from ATG3 to phosphatidylethanolamine (PE). This step is required for the membrane association of ATG8-like proteins. The formation of the ATG8-phosphatidylethanolamine conjugates is essential for autophagy and for the cytoplasm to vacuole transport (Cvt). Preferred substrate is MAP1LC3A. Also acts as an autocatalytic E2-like enzyme, catalyzing the conjugation of ATG12 to itself, ATG12 conjugation to ATG3 playing a role in mitochondrial homeostasis but not in autophagy. ATG7 (E1-like enzyme) facilitates this reaction by forming an E1-E2 complex with ATG3. Promotes primary ciliogenesis by removing OFD1 from centriolar satellites via the autophagic pathway.

Belongs to the ATG3 family.

35.864 kDa

MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLENKDNIRLQDCSALCEEEEDEDEGEAADMEEYEESGLLETDEATLDTRKIVEACKAKTDAGGEDAILQTRTYDLYITYDKYYQTPRLWLFGYDEQRQPLTVEHMYEDISQDHVKKTVTIENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEGGGELGVHMYLLIFLKFVQAVIPTIEYDYTRHFTM

Atg3

Ubiquitin-like-conjugating enzyme ATG3

314 amino acids

E2 conjugating enzyme required for the cytoplasm to vacuole transport (Cvt), autophagy, and mitochondrial homeostasis. Responsible for the E2-like covalent binding of phosphatidylethanolamine to the C-terminal Gly of ATG8-like proteins (GABARAP, GABARAPL1, GABARAPL2 or MAP1LC3A). The ATG12-ATG5 conjugate plays a role of an E3 and promotes the transfer of ATG8-like proteins from ATG3 to phosphatidylethanolamine (PE). This step is required for the membrane association of ATG8-like proteins. The formation of the ATG8-phosphatidylethanolamine conjugates is essential for autophagy and for the cytoplasm to vacuole transport (Cvt). Preferred substrate is MAP1LC3A. Also acts as an autocatalytic E2-like enzyme, catalyzing the conjugation of ATG12 to itself, ATG12 conjugation to ATG3 playing a role in mitochondrial homeostasis but not in autophagy. ATG7 (E1-like enzyme) facilitates this reaction by forming an E1-E2 complex with ATG3. ATG12-ATG3 conjugate is also formed upon viccina virus infection, leading to the disruption the cellular autophagy which is not necessary for vaccinia survival and proliferation. Promotes primary ciliogenesis by removing OFD1 from centriolar satellites via the autophagic pathway.

Belongs to the ATG3 family.

35.796 kDa

MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTDKQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLESKDSIKLQDCSALCDEEDEEDEGEAADMEEYEESGLLETDEATLDTRKIVEACKAKADAGGEDAILQTRTYDLYITYDKYYQTPRLWLFGYDEQRQPLTVEHMYEDISQDHVKKTVTIENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEGGGELGVHMYLLIFLKFVQAVIPTIEYDYTRHFTM

Atg3

Ubiquitin-like-conjugating enzyme ATG3

314 amino acids

E2 conjugating enzyme required for the cytoplasm to vacuole transport (Cvt), autophagy, and mitochondrial homeostasis. Responsible for the E2-like covalent binding of phosphatidylethanolamine to the C-terminal Gly of ATG8-like proteins (GABARAP, GABARAPL1, GABARAPL2 or MAP1LC3A). The ATG12-ATG5 conjugate plays a role of an E3 and promotes the transfer of ATG8-like proteins from ATG3 to phosphatidylethanolamine (PE). This step is required for the membrane association of ATG8-like proteins. The formation of the ATG8-phosphatidylethanolamine conjugates is essential for autophagy and for the cytoplasm to vacuole transport (Cvt). Preferred substrate is MAP1LC3A. Also acts as an autocatalytic E2-like enzyme, catalyzing the conjugation of ATG12 to itself, ATG12 conjugation to ATG3 playing a role in mitochondrial homeostasis but not in autophagy. ATG7 (E1-like enzyme) facilitates this reaction by forming an E1-E2 complex with ATG3 (By similarity).

Belongs to the ATG3 family.

35.822 kDa

MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLESKDSIKLQDCSVLCDEEEEEEEGEAADMEEYEESGLLETDEATLDTRRIVEACKAKADAGGEDAILQTRTYDLYITYDKYYQTPRLWLFGYDEQRQPLTVEHMYEDISQDHVKKTVTIENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEGGGELGVHMYLLIFLKFVQAVIPTIEYDYTRHFTM

atg3

Ubiquitin-like-conjugating enzyme ATG3

313 amino acids

E2 conjugating enzyme required for the cytoplasm to vacuole transport (Cvt), autophagy, and mitochondrial homeostasis. Responsible for the E2-like covalent binding of phosphatidylethanolamine to the C-terminal Gly of atg8-like proteins (gabarap, gabarapl1, gabarapl2 or map1lc3a). The atg12-atg5 conjugate plays a role of an E3 and promotes the transfer of atg8-like proteins from atg3 to phosphatidylethanolamine (PE). This step is required for the membrane association of atg8-like proteins. The formation of the atg8-phosphatidylethanolamine conjugates is essential for autophagy and for the cytoplasm to vacuole transport (Cvt). Also acts as an autocatalytic E2-like enzyme, catalyzing the conjugation of atg12 to itself, atg12 conjugation to atg3 playing a role in mitochondrial homeostasis but not in autophagy. atg7 (E1-like enzyme) facilitates this reaction by forming an E1-E2 complex with atg3 (By similarity).

Belongs to the ATG3 family.

35.644 kDa

MQNVFNTVKGKALEVAEYLTPVLKESKFKETGVITPEEFLAAGDHLVHHCPTWQWSAGEESKIKPYLPNDKQFLMTKNVPCYKRCKQMEYSDEQEAIIEEDDGDGGWVDTFHHTGLSGVTEAVKEITLETQDCGKTTDNIAVCDDDDDDEGEAADMEDYEESGLLENDDATVDTSKIKEACKPKADLGGEDAILQTRTYDLYITYDKYYQTPRLWLFGYDEQRRPLAVENMYEDISQDHVKKTVTIENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEGGGELGVHMYLLIFLKFVQAVIPTIEYDYTRHFTM

atg3

Ubiquitin-like-conjugating enzyme ATG3

312 amino acids

E2 conjugating enzyme required for the cytoplasm to vacuole transport (Cvt), autophagy, and mitochondrial homeostasis. Responsible for the E2-like covalent binding of phosphatidylethanolamine to the C-terminal Gly of atg8-like proteins (gabarap, gabarapl1, gabarapl2 or map1lc3a). The atg12-atg5 conjugate plays a role of an E3 and promotes the transfer of atg8-like proteins from atg3 to phosphatidylethanolamine (PE). This step is required for the membrane association of atg8-like proteins. The formation of the atg8-phosphatidylethanolamine conjugates is essential for autophagy and for the cytoplasm to vacuole transport (Cvt). Also acts as an autocatalytic E2-like enzyme, catalyzing the conjugation of atg12 to itself, atg12 conjugation to atg3 playing a role in mitochondrial homeostasis but not in autophagy. atg7 (E1-like enzyme) facilitates this reaction by forming an E1-E2 complex with atg3 (By similarity).

Belongs to the ATG3 family.

35.526 kDa

MQSVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFLAAGDHLVHHCPTWQWSAGEESKIKPYLPNDKQFLMTKNVPCYKRCKQMEYSDEQEAIIEEDDGDGGWVDTFHHSLTGVTEAVKEITLETQDCGKTTSNIAVDDDDDDDEGEAADMEDYEESGLLDNDDATVDTSKIKEACKPKADLGGEDAILQTRTYDLYITYDKYYQTPRLWLFGYDEQRRPLTVENMYEDISQDHVKKTVTIENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEGGGELGVHMYLLIFLKFVQAVIPTIEYDYTRHFTM

ATG3

Autophagy-related protein 3

310 amino acids

E2 conjugating enzyme required for the cytoplasm to vacuole transport (Cvt) and autophagy. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Responsible for the E2-like covalent binding of phosphatidylethanolamine to the C-terminal Gly of ATG8. The ATG12-ATG5 conjugate plays a role of an E3 and promotes the transfer of ATG8 from ATG3 to phosphatidylethanolamine (PE). This step is required for the membrane association of ATG8. The formation of the ATG8-phosphatidylethanolamine conjugate is essential for autophagy and for the cytoplasm to vacuole transport (Cvt). The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy (By similarity).

Belongs to the ATG3 family.

35.887 kDa

MIRSTLSSWREYLTPITHKSTFLTTGQITPEEFVQAGDYLCHMFPTWKWNEESSDISYRDFLPKNKQFLIIRKVPCDKRAEQCVEVEGPDVIMKGFAEDGDEDDVLEYIGSETEHVQSTPAGGTKDSSIDDIDELIQDMEIKEEDENDDTEEFNAKGGLAKDMAQERYYDLYIAYSTSYRVPKMYIVGFNSNGSPLSPEQMFEDISADYRTKTATIEKLPFYKNSVLSVSIHPCKHANVMKILLDKVRVVRQRRRKELQEEQELDGVGDWEDLQDDIDDSLRVDQYLIVFLKFITSVTPSIQHDYTMEGW

ATG3

Autophagy-related protein 3

310 amino acids

E2 conjugating enzyme required for the cytoplasm to vacuole transport (Cvt) and autophagy. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Responsible for the E2-like covalent binding of phosphatidylethanolamine to the C-terminal Gly of ATG8. The ATG12-ATG5 conjugate plays a role of an E3 and promotes the transfer of ATG8 from ATG3 to phosphatidylethanolamine (PE). This step is required for the membrane association of ATG8. The formation of the ATG8-phosphatidylethanolamine conjugate is essential for autophagy and for the cytoplasm to vacuole transport (Cvt). The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy.

Belongs to the ATG3 family.

35.887 kDa

MIRSTLSSWREYLTPITHKSTFLTTGQITPEEFVQAGDYLCHMFPTWKWNEESSDISYRDFLPKNKQFLIIRKVPCDKRAEQCVEVEGPDVIMKGFAEDGDEDDVLEYIGSETEHVQSTPAGGTKDSSIDDIDELIQDMEIKEEDENDDTEEFNAKGGLAKDMAQERYYDLYIAYSTSYRVPKMYIVGFNSNGSPLSPEQMFEDISADYRTKTATIEKLPFYKNSVLSVSIHPCKHANVMKILLDKVRVVRQRRRKELQEEQELDGVGDWEDLQDDIDDSLRVDQYLIVFLKFITSVTPSIQHDYTMEGW

ATG3

Autophagy-related protein 3

308 amino acids

E2 conjugating enzyme required for the cytoplasm to vacuole transport (Cvt) and autophagy (PubMed:26442587). Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production (By similarity). Responsible for the E2-like covalent binding of phosphatidylethanolamine to the C-terminal Gly of ATG8 (By similarity). The ATG12-ATG5 conjugate plays a role of an E3 and promotes the transfer of ATG8 from ATG3 to phosphatidylethanolamine (PE) (By similarity). This step is required for the membrane association of ATG8 (By similarity). The formation of the ATG8-phosphatidylethanolamine conjugate is essential for autophagy and for the cytoplasm to vacuole transport (Cvt) (By similarity). The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy (By similarity).

Belongs to the ATG3 family.

35.479 kDa

MLRSTLSNWREYLTPITHTSTFETTGQLTPEEFVKAGDYLVHMFPTWRWNGTDYNNVSYKDFLPKEKQFLITRKVPCKLRASNFVETQTTETRDVGDGWELEGQSEGERESGREDTKSNEEALASNIEDLQIVDDDESEGGGDEEQLLQNELADDDDDIVDIKPSTLRYYDLYITYSTSYRVPKMYLCGFANEGTPLSPDQMFEDIAPDYRSKTATIEPLPFFKGNQISVSIHPCKHANVMKVLMEKVRASRHRARDTEAQKNAEEDWEDLQSDIDDGLRVDQYLVVFLKFITSVTPGIEHDYTMEGW

ATG3

Autophagy-related protein 3

302 amino acids

E2 conjugating enzyme required for the cytoplasm to vacuole transport (Cvt) and autophagy. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Responsible for the E2-like covalent binding of phosphatidylethanolamine to the C-terminal Gly of ATG8. The ATG12-ATG5 conjugate plays a role of an E3 and promotes the transfer of ATG8 from ATG3 to phosphatidylethanolamine (PE). This step is required for the membrane association of ATG8. The formation of the ATG8-phosphatidylethanolamine conjugate is essential for autophagy and for the cytoplasm to vacuole transport (Cvt). The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy (By similarity).

Belongs to the ATG3 family.

35.069 kDa

MLRSTLSNWREYLTPISHTSTFETSGQLTPEEFVKAGDYLVHMFPTWKWNGNDFQNVHHKDFLPNDKQFLVTKKVPCKLRANNYLELDDTETKDVGDGWALQEEHSQDSERKSTNNADDSELPEELEELHIVDDGDDEEYDDQLYDNEFADDDIVDIRPSTLRFYDLYITYSTSYRVPKMYLCGYDNDGTPLSPDQMFEDIAADYRSKTATIEPLPFLKGNNISVSIHPCKHANVMKVLMEKVRSSRSRARKVDPQTTDEDWEDLQSDVDDGLRVDQYLVVFLKFITSVTPGIEHDYTMEGW

ATG3

Autophagy-related protein 3

293 amino acids

E2 conjugating enzyme required for the cytoplasm to vacuole transport (Cvt) and autophagy. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Responsible for the E2-like covalent binding of phosphatidylethanolamine to the C-terminal Gly of ATG8. The ATG12-ATG5 conjugate plays a role of an E3 and promotes the transfer of ATG8 from ATG3 to phosphatidylethanolamine (PE). This step is required for the membrane association of ATG8. The formation of the ATG8-phosphatidylethanolamine conjugate is essential for autophagy and for the cytoplasm to vacuole transport (Cvt). The ATG8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy (By similarity).

Belongs to the ATG3 family.

33.617 kDa

MLRSKLSSLREYLTPINHNSNYETSGEISPEEFVQAGDYLVYKFPTWQWGSAPKKLQKDFLPPDKQFLITKHVPSYQRAQSYLGNTEDLAEDEEELDDGWVKSHRLTHEDPKRDIATDKKVPDIEDLDDFIDEDAEDADGEEFQDLGNSNLRRYDLYITYSTSYRVPKMYLVGFNDNGIPLLPHQMFEDISGDYRDKTATIENLPVSFNTTSVSIHPCKHSSVMKVLMKHAKTSREKAREFEPEAFVTGENLEPATETTQDTGIRVDQYLVVFLKFIASVTPGIGYDYTMDAL

atg3

Autophagy-related protein 3

275 amino acids

E2 conjugating enzyme required for the cytoplasm to vacuole transport (Cvt) and autophagy. Required for selective autophagic degradation of the nucleus (nucleophagy) as well as for mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Responsible for the E2-like covalent binding of phosphatidylethanolamine to the C-terminal Gly of atg8. The atg12-atg5 conjugate plays a role of an E3 and promotes the transfer of atg8 from atg3 to phosphatidylethanolamine (PE). This step is required for the membrane association of atg8. The formation of the atg8-phosphatidylethanolamine conjugate is essential for autophagy and for the cytoplasm to vacuole transport (Cvt). The atg8-PE conjugate mediates tethering between adjacent membranes and stimulates membrane hemifusion, leading to expansion of the autophagosomal membrane during autophagy (By similarity). Plays a role in meiosis and sporulation.

Belongs to the ATG3 family.

31.886 kDa

MAQRLTSAFLNWREHITPASKTSDFENTGMISPEEFVLAGDYLVSKFPTWSWECGDRIRGFLPKDKQYLVTRHVFCVQRNINIGVNEEWVDIETDDTRNKDDDQDDDAISSIHSDTSDIASAERLKGQSKELSDSGPLPLKDEEDDDQMVSPVIKEDEGRYYDLYIVYDKYYRTPRLFLRGWNAGGQLLTMKDIYEDVSGEHAGKTVTMEPFPHYHSHNTMASVHPCKHASVLLKLIKQHRERNDPIRVDQYMVLFLKFVSTMLPYFEIDYTIQA