About Services Proteins Contact

ATEG_06693

Gene
ATEG_06693
Protein
UPF0499 protein ATEG_06693
Organism
Aspergillus terreus (strain NIH 2624 / FGSC A1156)
Length
116 amino acids
Similarity
Belongs to the UPF0499 family.
Mass
12.939 kDa
Sequence
MKLTGLLSLALLTTLALAAPDPKKNGPNRDWCGQVCTGKNDCSGECNKCVNFVCKRTSVLIYKEYLHKNATDHAARLNATRHLTIMIDETTRVDHVTVKFNVETYGMESITRRPEA