ARP4

Actin-related protein 4

534 amino acids

Chromatin interaction component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of selected genes principally by acetylation of nucleosomal histone H4 and H2A. The NuA4 complex is also involved in DNA repair. Is required for NuA4 complex integrity. Component of the SWR1 complex which mediates the ATP-dependent exchange of histone H2A for the H2A variant HZT1 leading to transcriptional regulation of selected genes by chromatin remodeling. Component of the INO80 complex which remodels chromatin by shifting nucleosomes and is involved in DNA repair (By similarity).

Belongs to the actin family. ARP4 subfamily.

56.97 kDa

MPGVYGGDEINALVIDAGHSSSRVGWAGEDAPRVVLPSYYGHTSITDDAIAELESQAAFATSSSSTVEPTERAEPVDGDETMADGQALSTSNGNGGAAATQEASDHRLRQARAKSASKTLRFSVDREKKRRRFVGDNELNLYRTNLEIAPIFDDDGMLADASAFAQLCSFGLDSLSCDASEHPLLLTEPAWNSRESREKLTELAFETLGSPAFYLANRSVLSSFAAGKPSSLVIDVGSTNVSTIPIVDGFILRKGIYRHNNGGEAINRALLYSLHHGRGATFAGVTPQYVIKSRSSVDPGTPANVVLRQERVQGASSSFRSYHINRVVNDFKESVAQVLEVPWDDQQAQFRSGRMYEFPDGYNDAFGVERLRAAEVLFTPALWNGVSSSESFGAVLHASSQPSSEAGAVNGGSVSAAGATSVAGGKAAIGLADMVLSSINAVDVDSRPSLYGNIVLVGGSSLIQGLSDRLSYELGVKAPNQKIKIHSPGNTTERRHSSWLGASILASLGTFHQLWISKQEYEEHGAAIVHARCK

ARP4

Actin-related protein 4

520 amino acids

Chromatin interaction component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of selected genes principally by acetylation of nucleosomal histone H4 and H2A. The NuA4 complex is also involved in DNA repair. Is required for NuA4 complex integrity. Component of the SWR1 complex which mediates the ATP-dependent exchange of histone H2A for the H2A variant HZT1 leading to transcriptional regulation of selected genes by chromatin remodeling. Component of the INO80 complex which remodels chromatin by shifting nucleosomes and is involved in DNA repair (By similarity).

Belongs to the actin family. ARP4 subfamily.

57.976 kDa

MSNPALQVYGGDEINAIVIDPGSFVTNIGYSGTDCPQSIMPSSYGNVETDGDTKRIFNEQPLLFPRAGMEIKPIVENSTIVDWDRAQEQWEYALNTDLKFESNKGTPVLLTEPIWNSEASRKKSLEILLESMEFEACYLAANSSAVSFAMGRPTCLVVDIGHDVSTVSPVIDGMTLSKSSTRNYVAGKYLNHLIAKNLKPREIVPIFQVLKKKPDFVKRTLSFDVNESVINFANERQFFQEFKETLLHIAPKSLSSFKDELATQTKRSLEAPWGEELIFDADTRYSFAEQLFRPVKEDFPEGWPASTDGIVKTWHNDYVPLKRTKPGTSTNTKEKENTAESTPVPASTEQEAVDSPSQEPNENGKRPVENKEDSSNNEQNSNEIKNEDANSNESSAKATVPSNGIQAKGEDEVAGIVDLINKSMMEADVDLRATLAHNVVLTGGTSKIPGLSDRIMHELNKSLPALKFRMLSSGHLRERQYQGWLGGSILASLGTFHQLWVGREEYEEVGPERLLKDRFR

ARP4

Actin-related protein 4

493 amino acids

Chromatin interaction component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of selected genes principally by acetylation of nucleosomal histone H4 and H2A. The NuA4 complex is also involved in DNA repair. Is required for NuA4 complex integrity. Component of the SWR1 complex which mediates the ATP-dependent exchange of histone H2A for the H2A variant HZT1 leading to transcriptional regulation of selected genes by chromatin remodeling. Component of the INO80 complex which remodels chromatin by shifting nucleosomes and is involved in DNA repair (By similarity).

Belongs to the actin family. ARP4 subfamily.

55.187 kDa

MSNSALQVYGGDEITAVIIDPGSYTTNIGYAGTDCPQSILPSSFGEIHEAEESTSEDNTEKTRKTRKVFSEQSIPIPRPDYEVKRVVENGQVCDWDSAVEQWSWALRNELHIESNRGIPAMLTEPLWNSKENRSKSLEILLEGMEFEACYLTATSTAVSFATGRPNSLIVDIGHDIASVTPVIDGMSLSKSTRCNHFAGRFLNKLLTDYLKPREIIPLFEVEQRKPEFKRRSFSYSVADSLYDYANSRGFFQECKETIFQVATTPIAQEKNNQATSTGRTIESPWNEVIEFESNDRYQFAEQLINPLKESVPDDWPVNVAGVVETWRNDYVPMKRNKVGSGNNKEKEGTKESTPLDSNTATPLPESSSTTNENGKRTAEDIKREELPGIVDLISSSISSCDVDIRASLAHNLVITGGSSTIPGLSDRILNELNMKFPALKFRVLATGQSIERQYQSWLGGSILSSLGTFHQLWIGKKEYEEVGSERLLHDRLR

ARP4

Actin-related protein 4

492 amino acids

Chromatin interaction component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of selected genes principally by acetylation of nucleosomal histone H4 and H2A. The NuA4 complex is also involved in DNA repair. Is required for NuA4 complex integrity. Component of the SWR1 complex which mediates the ATP-dependent exchange of histone H2A for the H2A variant HZT1 leading to transcriptional regulation of selected genes by chromatin remodeling. Component of the INO80 complex which remodels chromatin by shifting nucleosomes and is involved in DNA repair (By similarity).

Belongs to the actin family. ARP4 subfamily.

55.665 kDa

MSSSGNNASVYGGDEINAIVLDSSSFHTRIGYAGDDFPKIITPSSYASPNEDAMELDNKKKNGKSKSSKIFGESINIPRSNHNVSPILKDSVIIDWEAAIEQYHYYFDDVLTLNYKEQPILITEPVWCTPQYRQTLLETFYENFDFPALFLAKSPTCISFQQGRPNCLVVDIGHDSVSVTPVIDGISLLKNSMKTNYGGQYLNDQIEDMLTHKFSGVNFENRYRIKSKTPTVYPEESKYTVRDLSENITQSFDDYQRQNIWHEFKETMLEVPEKKFNTSNTSQANSLKEIYSQDSNKRLFELPTGQSLELCLERFQLADSLFDPQSYKFNNPDLATKYPPSNGELSLTNSYDDYKPLKRARKAESNQSTPPPSDAKKPSSKTSQIRGLTHLITHTLSTIDIDLRSSVAHNIIVTGGVSLIPQLTERLYSELSNSNPGLKIRLHAVGNSSERFNQAWIGGSVLASLGTFHQMWVSKQEYEEAGAERILNQRFR

ARP4

Actin-related protein 4

489 amino acids

Chromatin interaction component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of selected genes principally by acetylation of nucleosomal histone H4 and H2A. The NuA4 complex is also involved in DNA repair. ARP4 recognizes H2AS128ph (gamma-H2A) and is required for NuA4 complex integrity. Component of the SWR1 complex which mediates the ATP-dependent exchange of histone H2A for the H2A variant HZT1 leading to transcriptional regulation of selected genes by chromatin remodeling. Component of the INO80 complex which remodels chromatin by shifting nucleosomes. Its ability to induce transcription of some phosphate-responsive genes is modulated by inositol polyphosphates. The INO80 complex is involved in DNA repair by associating to gamma-H2A as a response to DNA damage.

Belongs to the actin family. ARP4 subfamily.

54.832 kDa

MSNAALQVYGGDEVSAVVIDPGSYTTNIGYSGSDFPQSILPSVYGKYTADEGNKKIFSEQSIGIPRKDYELKPIIENGLVIDWDTAQEQWQWALQNELYLNSNSGIPALLTEPVWNSTENRKKSLEVLLEGMQFEACYLAPTSTCVSFAAGRPNCLVVDIGHDTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIKKALEPKEIIPLFAIKQRKPEFIKKTFDYEVDKSLYDYANNRGFFQECKETLCHICPTKTLEETKTELSSTAKRSIESPWNEEIVFDNETRYGFAEELFLPKEDDIPANWPRSNSGVVKTWRNDYVPLKRTKPSGVNKSDKKVTPTEEKEQEAVSKSTSPAANSADTPNETGKRPLEEEKPPKENNELIGLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPSLKFRILTTGHTIERQYQSWLGGSILTSLGTFHQLWVGKKEYEEVGVERLLNDRFR

ARP4

Actin-related protein 4

479 amino acids

Chromatin interaction component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of selected genes principally by acetylation of nucleosomal histone H4 and H2A. The NuA4 complex is also involved in DNA repair. Is required for NuA4 complex integrity. Component of the SWR1 complex which mediates the ATP-dependent exchange of histone H2A for the H2A variant HZT1 leading to transcriptional regulation of selected genes by chromatin remodeling. Component of the INO80 complex which remodels chromatin by shifting nucleosomes and is involved in DNA repair (By similarity).

Belongs to the actin family. ARP4 subfamily.

53.866 kDa

MSNSALQVYGGDEITAVVIDPGSFTTNIGYSGTDCPQAILPSCYGKYTEGEKDELFSEQSIGLPRKDYEIHNIVQNGEVVDWEKAEKQWDWAIRSELRFETNSGMPALLTEPIWNSEENRKKSLEVLLESMDFSACYLVPTATAVSFAMGRPTCLVVDIGHDVTSVCPVVDGMTLSKSSMRSYIAGSLLNELIRSQLAPRKVIPLFQVAQRRPVFMERKFDYEIHPSLQKFVNERQFFQEFKETMLQVAPTSISKFKSEIETTSKRSIEAPWGEELVYDSLQRLEFAEQLFTPDLSQFPEDWPISKDGVVETWHNDYVPLKRNKPGTNVKDKEGTLDATPVPDENSVTSADQPNDNGKRNLEETTPDQKNEVSGLADLIYSSIMSTDVDLRTTLSHNVVITGGTSSLPGLMDRISAELNRSLPALKFRMLTSGQLRERQYQGWLGGSILASLGTFHQLWVGKQEYAEVGADRLLKDRFR

arp4

Actin-related protein 4

472 amino acids

Chromatin interaction component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of selected genes principally by acetylation of nucleosomal histone H4 and H2A. The NuA4 complex is also involved in DNA repair. Is required for NuA4 complex integrity. Component of the SWR1 complex which mediates the ATP-dependent exchange of histone H2A for the H2A variant HZT1 leading to transcriptional regulation of selected genes by chromatin remodeling. Component of the INO80 complex which remodels chromatin by shifting nucleosomes and is involved in DNA repair (By similarity).

Belongs to the actin family. ARP4 subfamily.

51.437 kDa

MNASVPPSAAEYGGDEVSAIVLDPGFSTTRAGFAGEDTPKSLVPTYYGKYSFEGQEKLIFGDDVFVTPRPSLSVGNPMGRDGVVEDWDMAEKLWEYSFTSRLTGAKPSNPLHNGLNDLVEGELPTEMEGVETNEKPLADSPLLMSECSWNPTKAREKTIEIAMEKWGTPAFYLARNGVLASFAAGKASALVVDIGASNISVTPVHDGMVLKRGVQHSPLGGDYISSQIRALFKTNTPQPITITPHYLISSKTAVEAGQPPQAKYKTFPPEKAPDASYRSLLEERTLTEFKECVVQVWPGPTKLSAPGPNGVPNEEMARSTPGRPFEFPDGYNQVFGVDRYRVVESLFDAKATILDPDSQFPAPTPAQTIPELIKAALNGVDVDLRPHLLANVVVTGASSLLYGFTDRLNQELMQLYPGPRVRISAPGNTSERRFSSWIGGSILASLGTFHQMWISKKEFDEHGPNIVEKRCK

ARP4

Actin-related protein 4

471 amino acids

Chromatin interaction component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of selected genes principally by acetylation of nucleosomal histone H4 and H2A. The NuA4 complex is also involved in DNA repair. Is required for NuA4 complex integrity. Component of the SWR1 complex which mediates the ATP-dependent exchange of histone H2A for the H2A variant HZT1 leading to transcriptional regulation of selected genes by chromatin remodeling. Component of the INO80 complex which remodels chromatin by shifting nucleosomes and is involved in DNA repair (By similarity).

Belongs to the actin family. ARP4 subfamily.

52.433 kDa

MAQQPLSSSAQPTDIYGGDEVSALVLDPGYCSTRAGFAGEDVPKSILPSFYGHVTGDNSRDLFGDECLIPRENYEVRNYMNKDSVVEDWDVAARIWENMLVNRLQPERQTPPSKNGLNDDPRPEGQDGEGDVAMDDAEAESMEKPLGENPLLVTEAPWNTPKAREKAIEIIMENWGCPAFWMSRTPVLAAFAAGKATSLVIDVGGANTSVTAIHDGMVLKRSIQKSPVGGIWLSSQIRSLFETSEPQVELTPTFMIENKTPVDALSSPSVRLRNFPYSITDSFRAYEEERVLTEFKESVVEVWRGPGRYSVPGNEEFVKTQPGRVFEMPDGYNQMWREQRFRVTEGMWDENAGYPIPEADRLNKTQTIPELIRAALNAVDVDLRGNLLANVVVTGSTSLINGFNDRLNTELMAMYPGLKIKIHAAGLTSERRFGAWIGGSILASLGTFHQMWISRKEYEENGPNVVEKRCK

ARP4

Actin-related protein 4

468 amino acids

Chromatin interaction component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of selected genes principally by acetylation of nucleosomal histone H4 and H2A. The NuA4 complex is also involved in DNA repair. Is required for NuA4 complex integrity. Component of the SWR1 complex which mediates the ATP-dependent exchange of histone H2A for the H2A variant HZT1 leading to transcriptional regulation of selected genes by chromatin remodeling. Component of the INO80 complex which remodels chromatin by shifting nucleosomes and is involved in DNA repair (By similarity).

Belongs to the actin family. ARP4 subfamily.

52.658 kDa

MATASTTTVYGGDEINAIVLDPGSYTTRIGYAGDDFPKVITSSYYGQVKNDKKKIFGESINVPRANYDIKPILKESIIVDWDAAIEQYQYYFDQQLKVVGPEQPILITEPIWTETSYRQQLVETFFENFEFSGIYLAKSPTCVSFQQGRSNCLVVDLGHDSVSVTPVIDGICLLKSSMKTNYGGKFLSNEIQDYLIDTKKVVMEPSFKIKSKIPTTYPDPPKYELKNNNTIPTSSSSSLSQSFLEFQNEKIYHNFKEILEVPEKNSSSGTTTTTTTTNKDSSRLFELPTGQSIVIDRFKIAESIFDPTIYKFTNSKLSFPPNNGEISITQANEYRPLKRVRKNDDEEEDSNQSTPKPEVNIRGISQLISHTLSNIDIDLRASLANNIIVTGGVSLISQLTERLYLELSNNNPGLKIRLHAVGNSTERINQAWIGGSVLASLGTFHQMWVTKEEYNEVGVDRILNQRFR

arp4

Actin-related protein 4

466 amino acids

Chromatin interaction component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of selected genes principally by acetylation of nucleosomal histone H4 and H2A. The NuA4 complex is also involved in DNA repair. Is required for NuA4 complex integrity. Component of the SWR1 complex which mediates the ATP-dependent exchange of histone H2A for the H2A variant HZT1 leading to transcriptional regulation of selected genes by chromatin remodeling. Component of the INO80 complex which remodels chromatin by shifting nucleosomes and is involved in DNA repair (By similarity).

Belongs to the actin family. ARP4 subfamily.

50.692 kDa

MLIAICVQDEISAIVLDPGFSTTRAGFAGEDTPKSVIPTYYGKYTYEAQEKLIFGDDIFVTPRPGLSIHNPMGRDGVVEDWDMAEKVWEYSFTSRLTGPKAGNPFQNGLNDVANGELPSEMEGVETEEKPLADSPLLMTECGWNPTKAREKTVEIAMEKWGTPAFYLARNGVLAAFAAGKASALVVDVGASNISVTPVHDGMILKRGVQHSPLGGDYISSQLRALFKTNSPQPITITPHYLVASKTAVDAGQPAQAKYKTFPPDKAPDASYRTLMEERTLSEFKECVVQVWPGPNKLSATGPNGVSNEEVAKSSPGRPFEFPDGYNQVFGIDRYRVVESLFDAKAAIPDPESVFPAPTQAQTVPELIKAALNGVDVDVRPHLLANVVVTGASSLLYGFTDRLNQELMQSYPGPRVRISASGNTAERKFGSWVGGSILASLGTFHQMWISKKEYDEHGPNIVEKRCK

ARP4

Actin-related protein 4

443 amino acids

Involved in several developmental processes including organization of plant organs, flowering time, anther development, flower senescence and fertility, probably by regulating the chromatin structure.

Belongs to the actin family. ARP4 subfamily.

48.494 kDa

MYGGDEVSAIVIDVGSYSCKAGYAGDDTPKAVFPSVVGSIEQTGETDEAKADKEAEAASDSKNGAKPMDVDKAKTKRKLYVGQELEFRRDHMEVISPMKDGTVTDWDIVDNIWNHAFRQRLLINPEEHPMLIAEPSTNTGQQREKAAELMFEKYKVPALFLAKNAVLTSFASGRATSLVVDSGGGSTVVAAVHDGYVLQKSVATSPIGGEFLTDCMMKSLESKGVVIRPRYSFKKKEVGPGEYKVVDLDLPNTTESYKLYCMRAIASDIKESVCRVPDTAFDEVAYANVPTTSYELPDGQTIEVGADRFKIPDILFNPSLSQTIPGVDGFADSMSVRGLPRMVIDSVNRCDVDIRKELLSSILLSGGSSSILQLKERLEKEVLEESSGNTRVKVLASGNSVERRFSVWIGGSILASLGSFQQMWFSKAEYEEHGVSYIQRKCP

ARP4

Actin-related protein 4

443 amino acids

Involved in several developmental processes including organization of plant organs, flowering time, anther development, flower senescence and fertility, probably by regulating the chromatin structure.

Belongs to the actin family. ARP4 subfamily.

48.494 kDa

MYGGDEVSAIVIDVGSYSCKAGYAGDDTPKAVFPSVVGSIEQTGETDEAKADKEAEAASDSKNGAKPMDVDKAKTKRKLYVGQELEFRRDHMEVISPMKDGTVTDWDIVDNIWNHAFRQRLLINPEEHPMLIAEPSTNTGQQREKAAELMFEKYKVPALFLAKNAVLTSFASGRATSLVVDSGGGSTVVAAVHDGYVLQKSVATSPIGGEFLTDCMMKSLESKGVVIRPRYSFKKKEVGPGEYKVVDLDLPNTTESYKLYCMRAIASDIKESVCRVPDTAFDEVAYANVPTTSYELPDGQTIEVGADRFKIPDILFNPSLSQTIPGVDGFADSMSVRGLPRMVIDSVNRCDVDIRKELLSSILLSGGSSSILQLKERLEKEVLEESSGNTRVKVLASGNSVERRFSVWIGGSILASLGSFQQMWFSKAEYEEHGVSYIQRKCP

ARP4

Actin-related protein 4

441 amino acids

Involved in several developmental processes including organization of plant organs, flowering time, anther development, flower senescence and fertility, probably by regulating the chromatin structure.

Belongs to the actin family. ARP4 subfamily.

48.937 kDa

MYGGDEVSAIVVDLGSHTCKAGYAGEDAPKAVFPSVIGAVDGVEAMDVDVDSTKTNSNSEDSKTESEKEKSKRKLYVGSQAMSYRRDHMEVLSPIKDGIVSDWDLVDNIWEHAFKSCLMIDPTEHPMLLAEPPLNTQQQREKAAELMFEKYKVPALFMAKNPVLTSFATGRATSLVVDCGGGSTTISPVHDGYVLQKAVVSSPLGGEFLTDCLLKSLESKGIKIRPRYSFKRKEVRAGEFQVEDVDIPDTTESYKLFCQRMIVGDIKDSICRVPDTPYDDKSYSNIPTTSYELPDGQTLEIGADRFKVPDVMFNPSIVQTIPGMEKYAEMIPSVRGLPHMVMESINKCDVDIRRELYSSILLAGGTSSMQQLKERLEKDLIEESPHSARVKVLASGNTTERRFSVWIGGSILASLGSFQQMWFSKSEYEEHGASYIQRKCP

ARP4

Actin-related protein 4

432 amino acids

Chromatin interaction component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of selected genes principally by acetylation of nucleosomal histone H4 and H2A. The NuA4 complex is also involved in DNA repair. Is required for NuA4 complex integrity. Component of the SWR1 complex which mediates the ATP-dependent exchange of histone H2A for the H2A variant HZT1 leading to transcriptional regulation of selected genes by chromatin remodeling. Component of the INO80 complex which remodels chromatin by shifting nucleosomes and is involved in DNA repair (By similarity).

Belongs to the actin family. ARP4 subfamily.

47.043 kDa

MTTTAPAPQVYGGDEVATLVIDTGSSYTRVGYAGEDTPKLVVSTECGLMADEDVEMEDDTSNTTKKLNKYKVGDSANLPLPNMEVLHPLTDGIVADWDAVQNIWEYSLARLNADTKTHPLMLTEPCWNTQANKLKALEIAFESLEVPASYLVKDAVASAFAAGKGNALVLDVGSEVASVTPVIDGLVLYKPARRSQYAGDYLDRQIKKVLVSRGIDLTPRFEIKNKKAVEMGEPPVFTKRELPNVTHSFTDLQVSRILSEFKDSMCQVNDVPLTPEISGEAADRVFEFPTGYSTTFGADRLSTSESLFKPSEYPFDGETVPDTARGLSEMVVDTINASNVDVRAHLANNIVITGGGSLVQGLSDRVSKDVTQALSGLKVRVAAASNQEERRHGAWIGGSVLGSLGSFHQLWVSKQEWQEKGGDYLVEKKRFK

arp4

IgA receptor

386 amino acids

Binds IgA of both subclasses, and also binds polyclonal IgG weakly.

Belongs to the M protein family.

43.837 kDa

MARKDTNKQYSLRKLKTGTASVAVAVAVLGAGFANQTEVKAAEIKKPQADSAWNWPKEYNALLKENEELKVEREKYLSYADDKEKDPQYRALMGENQDLRKREGQYQDKIEELEKERKEKQERQEQLERQYQIEADKHYQEQQKKHQQEQQQLEAEKQKLAKDKQISDASRQGLSRDLEASRAAKKELEAEHQKLKEEKQISDASRQGLSRDLEASREAKKKVEADLAALTAEHQKLKEDKQISDASRQGLSRDLEASREAKKKVEADLAEANSKLQALEKLNKELEEGKKLSEKEKAELQARLEAEAKALKEQLAKQAEELAKLKGNQTPNAKVAPQANRSRSAMTQQKRTLPSTGETANPFFTAAAATVMVSAGMLALKRKEEN