ARL2

ADP-ribosylation factor-like protein 2

185 amino acids

Has a role in the cofactor-dependent pathway of microtubule biogenesis. Not essential for cell viability. May play a regulatory role in sequestring TFCD.

Belongs to the small GTPase superfamily. Arf family.

21.077 kDa

MGLLSIIRKIKKKEKEMRILMVGLDNSGKTTIVLKINGEDTSVISPTLGFNIKTIIYQKYTLNIWDVGGQKTIRSYWRNYFEQTDGLVWVVDSSDLRRLDDCKMELDNLLKEERLAGSSLLILANKQDIQGALTPDEIGKVLNLESMDKSRHWKIVGCSAYTGEGLLEGFDWLVQDIASRIYMLD

ARL2

ADP-ribosylation factor-like protein 2

184 amino acids

Small GTP-binding protein which cycles between an inactive GDP-bound and an active GTP-bound form, and the rate of cycling is regulated by guanine nucleotide exchange factors (GEF) and GTPase-activating proteins (GAP). GTP-binding protein that does not act as an allosteric activator of the cholera toxin catalytic subunit. Regulates formation of new microtubules and centrosome integrity. Prevents the TBCD-induced microtubule destruction. Participates in association with TBCD, in the disassembly of the apical junction complexes. Antagonizes the effect of TBCD on epithelial cell detachment and tight and adherens junctions disassembly. Together with ARL2, plays a role in the nuclear translocation, retention and transcriptional activity of STAT3. Component of a regulated secretory pathway involved in Ca(2+)-dependent release of acetylcholine. Required for normal progress through the cell cycle.

Belongs to the small GTPase superfamily. Arf family.

20.907 kDa

MGLLTILKKMKQKERELRLLMLGLDNAGKTTILKKFNGEDIDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQNLLVEERLAGATLLIFANKQDLPGALSSNAIREALELDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSRIFMAD

arl2

ADP-ribosylation factor-like protein 2

184 amino acids

May be involved in trafficking events within the endosomal system.

Belongs to the small GTPase superfamily. Arf family.

21.226 kDa

MGLLTVLKKLKQKEKELRILMLGLDNAGKTTILKKFNGEDISTISPTLGFNIQTLMYKEYKLNIWDIGGQKTLRSYWRNYYEENDAVIWVIDSSDIRRIDDCKFELKKLLEEEKFAGASFLVFANKQDLDGAMTSEEISKYLDLEQLNTHHWEIMSCSAVTGLGLEEGIDWVVKDIVSRCFVLD

Arl2

ADP-ribosylation factor-like protein 2

184 amino acids

GTP-binding protein involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.

Belongs to the small GTPase superfamily. Arf family.

20.834 kDa

MGFLTVLKKMRQKEREMRILLLGLDNAGKTTILKRFNGEPIDTISPTLGFNIKTLEHNGYTLNMWDVGGQKSLRSYWRNYFESTDGLVWVVDSADRMRLESCGQELQVLLQEERLAGATLLVLCNKQDLPGALSSNEIKEILHLEDITTHHWLVAGVSAVTGEKLLSSMDWLIADIAKRIFTLD

ARL2

ADP-ribosylation factor-like protein 2

184 amino acids

Small GTP-binding protein which cycles between an inactive GDP-bound and an active GTP-bound form, and the rate of cycling is regulated by guanine nucleotide exchange factors (GEF) and GTPase-activating proteins (GAP). GTP-binding protein that does not act as an allosteric activator of the cholera toxin catalytic subunit. Regulates formation of new microtubules and centrosome integrity. Prevents the TBCD-induced microtubule destruction. Participates in association with TBCD, in the disassembly of the apical junction complexes. Antagonizes the effect of TBCD on epithelial cell detachment and tight and adherens junctions disassembly. Together with ARL2, plays a role in the nuclear translocation, retention and transcriptional activity of STAT3. Component of a regulated secretory pathway involved in Ca(2+)-dependent release of acetylcholine. Required for normal progress through the cell cycle.

Belongs to the small GTPase superfamily. Arf family.

20.878 kDa

MGLLTILKKMKQKERELRLLMLGLDNAGKTTILKKFNGEDIDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSSNAIREVLELDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSRIFTAD

Arl2

ADP-ribosylation factor-like protein 2

184 amino acids

Small GTP-binding protein which cycles between an inactive GDP-bound and an active GTP-bound form, and the rate of cycling is regulated by guanine nucleotide exchange factors (GEF) and GTPase-activating proteins (GAP). GTP-binding protein that does not act as an allosteric activator of the cholera toxin catalytic subunit. Regulates formation of new microtubules and centrosome integrity. Prevents the TBCD-induced microtubule destruction. Participates in association with TBCD, in the disassembly of the apical junction complexes. Antagonizes the effect of TBCD on epithelial cell detachment and tight and adherens junctions disassembly. Together with ARL2, plays a role in the nuclear translocation, retention and transcriptional activity of STAT3. Component of a regulated secretory pathway involved in Ca(2+)-dependent release of acetylcholine. Required for normal progress through the cell cycle.

Belongs to the small GTPase superfamily. Arf family.

20.864 kDa

MGLLTILKKMKQKERELRLLMLGLDNAGKTTILKKFNGEDVDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSCNAIQEALELDSIRSHHWRIQGCSAVTGEDLLPGIDWLLDDISSRVFTAD

Arl2

ADP-ribosylation factor-like protein 2

184 amino acids

Small GTP-binding protein which cycles between an inactive GDP-bound and an active GTP-bound form, and the rate of cycling is regulated by guanine nucleotide exchange factors (GEF) and GTPase-activating proteins (GAP). GTP-binding protein that does not act as an allosteric activator of the cholera toxin catalytic subunit. Regulates formation of new microtubules and centrosome integrity. Prevents the TBCD-induced microtubule destruction. Participates in association with TBCD, in the disassembly of the apical junction complexes. Antagonizes the effect of TBCD on epithelial cell detachment and tight and adherens junctions disassembly. Together with ARL2, plays a role in the nuclear translocation, retention and transcriptional activity of STAT3. Component of a regulated secretory pathway involved in Ca(2+)-dependent release of acetylcholine. Required for normal progress through the cell cycle (By similarity).

Belongs to the small GTPase superfamily. Arf family.

20.836 kDa

MGLLTILKKMKQKERDVRLLMLGLDNAGKTTILKKFNGEDVDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSCNAIQEALELDSIRSHHWRIQGCSAVTGEDLLPGIDWLLDDISSRVFTAD