Function
Forms a channel that mediates water and glycerol transport across cell membranes at neutral pH (PubMed:15591341, PubMed:15746100, PubMed:16009937). The channel is also permeable to urea (By similarity). Plays an important role in body energy homeostasis under conditions that promote lipid catabolism, giving rise to glycerol and free fatty acids (PubMed:15591341, PubMed:16009937). Mediates glycerol export from adipocytes (PubMed:15591341, PubMed:15746100, PubMed:16009937). After release into the blood stream, glycerol is used for gluconeogenesis in the liver to maintain normal blood glucose levels and prevent fasting hypoglycemia (PubMed:15591341). Required for normal glycerol reabsorption in the kidney (PubMed:15998844, PubMed:17077387).
Sequence
MAPRSVLETIQSVLQKNMVREFLAEFLSTYVMMVFGLGSVAHMVLGENSGSYLGVNLGFGFGVTMGVHVAGGISGAHMNAAVTFTNCALGRMTWKKFPVYVLGQFLGSFSAAATTYLIFYGAINHFAGGDLLVTGSKATANIFATYLPEYMTLWRGFLDEAFVTGMLQLCLFAITDKKNSPALQGTEPLVIGILVTVLGVSLGMNSGYAINPSRDLPPRLFTFIAGWGKQVFRAGNNWWWVPVVAPLLGAYLGGIVYLGLIHPSIPQDPQRLENFTARDQKVTASYKNAASANISGSVPLEHF