APOC1B

Apolipoprotein C-I, basic form

83 amino acids

Belongs to the apolipoprotein C1 family.

9.36 kDa

MRLFLSLPVLVVVLSMVLEGPAPAQGAPDVSSALDKLKEFGNTLEDKAREVINRIKQSEFPAKTRDWFSETFRKVKEKLKINS

APOC1B

Apolipoprotein C-I, basic form

83 amino acids

Inhibitor of lipoprotein binding to the low density lipoprotein (LDL) receptor, LDL receptor-related protein, and very low density lipoprotein (VLDL) receptor. Associates with high density lipoproteins (HDL) and the triacylglycerol-rich lipoproteins in the plasma and makes up about 10% of the protein of the VLDL and 2% of that of HDL. Appears to interfere directly with fatty acid uptake and is also the major plasma inhibitor of cholesteryl ester transfer protein (CETP). Binds free fatty acids and reduces their intracellular esterification. Modulates the interaction of APOE with beta-migrating VLDL and inhibits binding of beta-VLDL to the LDL receptor-related protein.

Belongs to the apolipoprotein C1 family.

9.39 kDa

MRLFLSLPVLVVVLSMVLEGPAPAQGAPDVSSALDKLKEFGNTLEDKAWEVINRIKQSEFPAKTRDWFSETFRKVKEKLKINS

APOC1B

Apolipoprotein C-I, basic form

83 amino acids

Inhibitor of lipoprotein binding to the low density lipoprotein (LDL) receptor, LDL receptor-related protein, and very low density lipoprotein (VLDL) receptor. Associates with high density lipoproteins (HDL) and the triacylglycerol-rich lipoproteins in the plasma and makes up about 10% of the protein of the VLDL and 2% of that of HDL. Appears to interfere directly with fatty acid uptake and is also the major plasma inhibitor of cholesteryl ester transfer protein (CETP). Binds free fatty acids and reduces their intracellular esterification. Modulates the interaction of APOE with beta-migrating VLDL and inhibits binding of beta-VLDL to the LDL receptor-related protein.

Belongs to the apolipoprotein C1 family.

9.39 kDa

MRLFLSLPVLVVVLSMVLEGPAPAQGAPDVSSALDKLKEFGNTLEDKAWEVINRIKQSEFPAKTRDWFSETFRKVKEKLKINS

APOC1B

Apolipoprotein C-I, basic form

83 amino acids

Inhibitor of lipoprotein binding to the low density lipoprotein (LDL) receptor, LDL receptor-related protein, and very low density lipoprotein (VLDL) receptor. Associates with high density lipoproteins (HDL) and the triacylglycerol-rich lipoproteins in the plasma and makes up about 10% of the protein of the VLDL and 2% of that of HDL. Appears to interfere directly with fatty acid uptake and is also the major plasma inhibitor of cholesteryl ester transfer protein (CETP). Binds free fatty acids and reduces their intracellular esterification. Modulates the interaction of APOE with beta-migrating VLDL and inhibits binding of beta-VLDL to the LDL receptor-related protein.

Belongs to the apolipoprotein C1 family.

9.39 kDa

MRLFLSLPVLVVVLSMVLEGPAPAQGAPDVSSALDKLKEFGNTLEDKAWEVINRIKQSEFPAKTRDWFSETFRKVKEKLKINS

APOC1B

Apolipoprotein C-I, basic form

83 amino acids

Belongs to the apolipoprotein C1 family.

9.359 kDa

MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQNELSAKMREWFSETFQKVKEKLKIDS

APOC1B

Apolipoprotein C-I, basic form

83 amino acids

Inhibitor of lipoprotein binding to the low density lipoprotein (LDL) receptor, LDL receptor-related protein, and very low density lipoprotein (VLDL) receptor. Associates with high density lipoproteins (HDL) and the triacylglycerol-rich lipoproteins in the plasma and makes up about 10% of the protein of the VLDL and 2% of that of HDL. Appears to interfere directly with fatty acid uptake and is also the major plasma inhibitor of cholesteryl ester transfer protein (CETP). Binds free fatty acids and reduces their intracellular esterification. Modulates the interaction of APOE with beta-migrating VLDL and inhibits binding of beta-VLDL to the LDL receptor-related protein.

Belongs to the apolipoprotein C1 family.

9.418 kDa

MRLFLSLPVLVVVLSMVLEGPAPVQGAPDVSSALDKLKEFGNTLEDKAWEVINRIKQSEFPAKTRDWFSETFRKVKEKLKINS

APOC1B

Apolipoprotein C-I, basic form

65 amino acids

Belongs to the apolipoprotein C1 family.

7.118 kDa

single

MRLFLSLPVLVVVLSMVLEGPAPAQGAPDVSSALDKLKEFGNTLEDKAWEVINRIKQSELPAKTR

APOC1B

Apolipoprotein C-I, basic form

65 amino acids

Belongs to the apolipoprotein C1 family.

7.078 kDa

MRLFLSLPVLVVVLSMVLEGPAPAQGAPDVSSALDKLKEFGNTLEDKAREVINRIKQSELSAKTR