APO1

APO protein 1, chloroplastic

436 amino acids

Involved in the stable assembly of several 4Fe-4S cluster-containing complexes of chloroplasts. May participate in 4Fe-4S cofactor incorporation into psaA and/or psaB during translation.

Belongs to the APO family.

49.627 kDa

MLLVSPACRGVYLQTIDPKPIDFSARASYALCFQIPTSIPKRECLMRLGTVFCFNQKHREQTSFKKRYVSTQNVDLPPILPKNKKKPYPIPFKQIQEEARKDKKLAQMGIEKQLDPPKNGLLVPNLVPVADQVIDNWKLLIKGLAQLLHVVPVFACSECGAVHVANVGHNIRDCNGPTNSQRRGSHSWVKGTINDVLIPVESYHMYDPFGRRIKHETRFEYERIPALVELCIQAGVEIPEYPCRRRTQPIRMMGKRVIDRGGYHKEPEKPQTSSSLSSPLAELDTLGVFERYPPPTPEDIPKIAQETMDAYEKVRLGVTKLMRKFTVKACGYCSEVHVGPWGHSVKLCGEFKHQWRDGKHGWQDALVDEVFPPNYVWHVRDLKGNPLTGNLRRFYGKAPALVEICMHSGARVPQRYKAMMRLDIIVPDSQEADMVA

APO1

Protein ABERRANT PANICLE ORGANIZATION 1

429 amino acids

Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity). Together with FL/APO2, involved in the temporal regulation of meristem identity during both vegetative and reproductive developments in an APO2-dependent manner (By similarity). Promotes spikelet formation by suppressing the precocious conversion of inflorescence meristems to spikelet meristems, probably via a positive regulation of class-C floral homeotic genes, but not of class-B genes, and through the control of cell proliferation in meristems (PubMed:21119645). Mediates culm development and strength/diameter enhancement at internodes (PubMed:21119645). Required for the regulation of the plastochron, floral organ identity, and floral determinacy (By similarity). Controls the number of primary rachis branches (PRBs) (PubMed:20151298). May trigger the formation of vascular bundle systems which, consequently, promote carbohydrate translocation to panicles (PubMed:20151298). Involved in ozone-induced grain yield regulation (PubMed:25923431).

44.909 kDa

MMNPRRLPPLPSSTSSASAADDMDPRVWRRLPQPLVDRVLACLPTPSFLRLRAACRRFYHLLFSSPFLHSHLLLSPHLPFFAFVVPAAGHLLLLDPTATASWSRLPLPLPPVAGGPAAFSPAAASAGLLAFLSDASGHKTLLLANPITRLLAALPISPTPRLSPTVGLAAGPTSIIAVVAGDDLVSPFAVKNISADTFVADAASVPPSGFWAPSSLLPRLSSLDPGAGMAFASGRFYCMSSSPFAVLVFDVAENVWSKVQPPMRRFLRSPALVELGGGREGAARVALVSAVEKSRLSVPRSVRLWTLRGGGGGGGGGAWTEVARMPPEVHAQFAAAEGGRGFECAAHGDYVVLAPRGPVAQAPTSALVFDSRRDEWRWAPPCPYVVVAHHGGAGAAGFRVFAYEPRLATPAIGLLDATAPVALHGMHDG

APO1

Protein ABERRANT PANICLE ORGANIZATION 1

429 amino acids

Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity). Together with FL/APO2, involved in the temporal regulation of meristem identity during both vegetative and reproductive developments in an APO2-dependent manner (PubMed:17666027, Ref.5, Ref.6, PubMed:15950602, PubMed:19386809, PubMed:21910771). Promotes spikelet formation by suppressing the precocious conversion of inflorescence meristems to spikelet meristems, probably via a positive regulation of class-C floral homeotic genes, but not of class-B genes, and through the control of cell proliferation in meristems (PubMed:17666027, Ref.6, PubMed:19386809, PubMed:21119645). Mediates culm development and strength/diameter enhancement at internodes (PubMed:21119645, PubMed:25381289). Required for the regulation of the plastochron, floral organ identity, and floral determinacy (PubMed:17666027, Ref.6, PubMed:15950602, PubMed:19386809). Controls the number of primary rachis branches (PRBs) (PubMed:20151298). May trigger the formation of vascular bundle systems which, consequently, promote carbohydrate translocation to panicles (PubMed:20151298). Involved in ozone-induced grain yield regulation (PubMed:25923431).

45.022 kDa

MMNPRRLPPLPSSTSSASAADDMDPRVWRRLPQPLVDRILACLPTPSFLRLRAACRRFYHLLFSSPFLHSHLLLSPHLPFFAFVVPAAGHLLLLDPTATASWSRLPLPLPPVAGGPAAFSPAAASAGLLAFLSDASGHKTLLLANPITRLLAALPISPTPRLSPTVGLAAGPTSIIAVVAGDDLVSPFAVKNISADTFVADAASVPPSGFWAPSSLLPRLSSLDPRAGMAFASGRFYCMSSSPFAVLVFDVAENVWSKVQPPMRRFLRSPALVELGGGREGAARVALVSAVEKSRLSVPRSVRLWTLRGGGGGGGGGAWTEVARMPPEVHAQFAAAEGGRGFECAAHGDYVVLAPRGPVAQAPTSALVFDSRRDEWRWAPPCPYVVVAHHGGAGAAGFRVFAYEPRLATPAIGLLDATAPVALHGMHDG

APO1

Aromatic peroxygenase

371 amino acids

Aromatic peroxidase that oxidizes aryl alcohols into the corresponding aldehydes and then into the corresponding benzoic acids. Oxidizes toluene and naphthalene. Catalyzes the regioselective peroxide-dependent hydroxylation of propranolol and diclofenac to 5-hydroxypropranolol and 4'-hydroxydiclofenac. Catalyzes the regioselective peroxide-dependent hydroxylation of naphthalene to 1-naphthol or 2-naphthol via a naphthalene 1,2-oxide intermediate. Catalyzes the regioselective peroxide-dependent oxidation of pyridine to pyridine N-oxide. Halogenates monochlorodimedone and phenol. Oxidizes the sulfur-containing heterocycle dibenzothiophene to yield ring-hydroxylation products and to a lesser extent sulfoxidation products.

Belongs to the chloroperoxidase family.

40.652 kDa

MKYFPLFPTLVFAARVVAFPAYASLAGLSQQELDAIIPTLEAREPGLPPGPLENSSAKLVNDEAHPWKPLRPGDIRGPCPGLNTLASHGYLPRNGVATPVQIINAVQEGLNFDNQAAVFATYAAHLVDGNLITDLLSIGRKTRLTGPDPPPPASVGGLNEHGTFEGDASMTRGDAFFGNNHDFNETLFEQLVDYSNRFGGGKYNLTVAGELRFKRIQDSIATNPNFSFVDFRFFTAYGETTFPANLFVDGRRDDGQLDMDAARSFFQFSRMPDDFFRAPSPRSGTGVEVVIQAHPMQPGRNVGKINSYTVDPTSSDFSTPCLMYEKFVNITVKSLYPNPTVQLRKALNTNLDFFFQGVAAGCTQVFPYGRD