anr

Annetocin receptor

420 amino acids

Receptor for annetocin. Activation by annetocin may induce egg-laying behavior through calcium-dependent signaling.

Belongs to the G-protein coupled receptor 1 family. Vasopressin/oxytocin receptor subfamily.

46.41 kDa

MEMDDDEAILLDDIYALASTPNQTIVTSSFPQTVSPGFLARRNEALAMVEVAVQSTILILTVVGNAAVLAMIVSLSRHKDLGRMYTMIGHLSCADLFVAIFNLLPQLLWDVTHRFRGGRVLCKLVKYVQVVAMYASAYVLMSTAVDRYTAICHPMRSHTWTSTTAHYLVIGAWVLALVFAVPQLVIFDYVEVVPGSGVYDCVDHFRPRWTLPVYITWFALAVYVIPLVVLATIYLRICVVVWKSANRKSTPMINVAARTSGATEQPSLDDASVSFNVADGGGVDLDPSGGGGSLSRHAAQLSHRQQQQQANNVVLSRAKTKTVKLTLTVVISYLVCWAPFFVSHIWSAWDPHAPFEGTEMVITLLLGSLNSCINPWIYLAFSDQLRRKVTQCCPRSWGQRPSTLSHDSTDFRSGSRPTHS

ANR

Anthocyanidin reductase ((2S)-flavan-3-ol-forming)

338 amino acids

Produces the terminal flavan-3-ol monomers required for the formation of proanthocyanidins or condensed tannins in leaves and flowers, as well as in the skin and seeds of developing berries (By similarity). Behaves as a reductase and as a C-3 epimerase (By similarity). Catalyzes the double reduction of anthocyanidins, producing a mixture of (2S,3S)- and (2S,3R)-flavan-3-ols (By similarity). The enzyme catalyzes sequential hydride transfers to C-2 and C-4, respectively and epimerization at C-3 is achieved by tautomerization that occurs between the two hydride transfers (By similarity). Converts cyanidin, pelargonidin and delphinidin into catechin and epicatechin, afzelechin and epiafzelechin, and gallocatechin and epigallocatechin respectively (PubMed:16806954).

Belongs to the NAD(P)-dependent epimerase/dehydratase family. Dihydroflavonol-4-reductase subfamily.

36.735 kDa

MATQHPIGKKTACVVGGTGFVASLLVKLLLQKGYAVNTTVRDPDNQKKVSHLLELQELGDLKIFRADLTDELSFEAPIAGCDFVFHVATPVHFASEDPENDMIKPAIQGVVNVMKACTRAKSVKRVILTSSAAAVTINQLDGTGLVVDEKNWTDIEFLTSAKPPTWGYPASKTLAEKAAWKFAEENNIDLITVIPTLMAGSSLTSDVPSSIGLAMSLITGNEFLINGMKGMQMLSGSVSIAHVEDVCQAHIFVAEKESASGRYICCAANTSVPELAKFLSKRYPQYKVPTDFGDFPPKSKLIISSEKLVKEGFSFKYGIEEIYDESVEYFKAKGLLQN

ANR

Anthocyanidin reductase ((2S)-flavan-3-ol-forming)

338 amino acids

Produces the terminal flavan-3-ol monomers required for the formation of proanthocyanidins or condensed tannins in leaves and flowers, as well as in the skin and seeds of developing berries (Ref.1, PubMed:16169968). Behaves as a reductase and as a C-3 epimerase (PubMed:20030585). Catalyzes the double reduction of anthocyanidins, producing a mixture of (2S,3S)- and (2S,3R)-flavan-3-ols (Ref.1). The enzyme catalyzes sequential hydride transfers to C-2 and C-4, respectively and epimerization at C-3 is achieved by tautomerization that occurs between the two hydride transfers (PubMed:20030585). Converts cyanidin, pelargonidin and delphinidin into catechin and epicatechin, afzelechin and epiafzelechin, and gallocatechin and epigallocatechin respectively (PubMed:19690377).

Belongs to the NAD(P)-dependent epimerase/dehydratase family. Dihydroflavonol-4-reductase subfamily.

36.763 kDa

MATQHPIGKKTACVVGGTGFVASLLVKLLLQKGYAVNTTVRDPDNQKKVSHLLELQELGDLKIFRADLTDELSFEAPIAGCDFVFHVATPVHFASEDPENDMIKPAIQGVVNVMKACTRAKSVKRVILTSSAAAVTINQLDGTGLVVDEKNWTDIEFLTSAKPPTWGYPASKTLAEKAAWKFAEENNIDLITVIPTLMAGSSLTSDVPSSIGLAMSLITGNEFLINGMKGMQMLSGSVSIAHVEDVCRAHIFVAEKESASGRYICCAANTSVPELAKFLSKRYPQYKVPTDFGDFPPKSKLIISSEKLVKEGFSFKYGIEEIYDESVEYFKAKGLLQN

ANR

Anthocyanidin reductase ((2S)-flavan-3-ol-forming)

338 amino acids

Produces the terminal flavan-3-ol monomers required for the formation of proanthocyanidins or condensed tannins in leaves and flowers, as well as in the skin and seeds of developing berries. Behaves as a reductase and as a C-3 epimerase. Catalyzes the double reduction of anthocyanidins, producing a mixture of (2S,3S)- and (2S,3R)-flavan-3-ols. The enzyme catalyzes sequential hydride transfers to C-2 and C-4, respectively and epimerization at C-3 is achieved by tautomerization that occurs between the two hydride transfers. Converts cyanidin, pelargonidin and delphinidin into catechin and epicatechin, afzelechin and epiafzelechin, and gallocatechin and epigallocatechin respectively.

Belongs to the NAD(P)-dependent epimerase/dehydratase family. Dihydroflavonol-4-reductase subfamily.

36.725 kDa

MATQHPIGKKTACVVGGTGFVASLLVKLLLQKGYAVNTTVRDPDNQKKVSHLLELQELGDLKIFRADLTDELSFEAPIAGCDFVFHVATPVHFASEDPENDMIKPAVQGVVNVMKACTRAKSVKRVILTSSAAAVTINQLDGTGLVVDEKNWTDIEFLTSAKPPTWGYPASKTLAEKAAWKFAEENNIDLITVIPTLMAGSSLTSDVPSSIGLAMSLITGNEFLINGMKGMQMLSGSVSIAHVEDVCRAHIFVAEKESASGRYICCAANTSVPELAKFLSKRYPQYKVPTDFGDFPSKSKLIISSDKLVKEGFSFKYGIEEIYDESVEYFKAKGLLQN

anr

Transcriptional activator protein anr

244 amino acids

Transcriptional activator of anaerobic gene expression.

27.129 kDa

MAETIKVRALPQAHCKDCSLAPLCLPLSLTVEDMDSLDEIVKRGRPLKKGEFLFRQGDPFGSVFAVRSGALKTFSITDAGEEQITGFHLPSELVGLSGMDTETYPVSAQALETTSVCEIPFERLDELSEQLPQLRRQLMRLMSREIRDDQQMMLLLSKKTADERIATFLVNLSARFRARGFSAQQFRLAMSRNEIGNYLGLAVETVSRVFTRFQQNGLISAEGKEVHILDSIELCALAGGQLEG

anr

Transcriptional activator protein Anr

244 amino acids

Transcriptional activator of anaerobic gene expression. Regulates the expression of the components of the hydrogen cyanide synthase (HcnABC) in a positive manner (PubMed:10570200). May also act as an iron sensor.

27.155 kDa

MSEPVKLRAHNQAHCKDCSLAPLCLPLSLNLEDMDALDEIVKRGRPLKKGEFLFRQGDGFDSVYAVRSGALKTFSLSDSGEEQITGFHLPSELVGLSGMDTESHPVSAQALETTSVCEIPFERLDELALQLPQLRRQLMRVMSREIRDDQQMMLLLSKKTADERIATFLVNLSARFRARGFSANQFRLSMSRNEIGNYLGLAVETVSRVFTRFQQNELIAAEGKEVHILDPIQLCALAGGSVEG