ALKBH8

Alkylated DNA repair protein alkB homolog 8

664 amino acids

Catalyzes the methylation of 5-carboxymethyl uridine to 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in tRNA via its methyltransferase domain. Catalyzes the last step in the formation of 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in target tRNA. Has a preference for tRNA(Arg) and tRNA(Glu), and does not bind tRNA(Lys). Binds tRNA and catalyzes the iron and alpha-ketoglutarate dependent hydroxylation of 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in tRNA via its dioxygenase domain, giving rise to 5-(S)-methoxycarbonylhydroxymethyluridine; has a preference for tRNA(Gly). Required for normal survival after DNA damage. May inhibit apoptosis and promote cell survival and angiogenesis (By similarity).

Belongs to the alkB family.

75.193 kDa

MDSNHQSNYKLSKTEKKLLRKQIKARHTLLRHEGIETVSYATQSLIVANGGLGNQVSRNQLLPVLEKCGLVDALLMPPNKPYSCVRYKTVEESKTAYDTLNGKEIVDDLGQKIILYLNFVEKAQWKELGLQALPPGLKVIEEIISSEDEKMLLESVNWTEDTENQNFQKSLKHRRVKHFGYEFHYENNNVDKDKPLPGGLPDICESILEKWLKEGFIKHKPDQLTINQYEPGHGIPAHIDTHSAFEDEIISLSLGSEIVMDFKHPDGMTVPVMLPCRSLLVMTGESRYLWTHGITPRKFDTVQASKGHKSGIITSDVEDLTLNKRGIRTSFTFRKVRQTPCNCSYPLVCDSQMKETPASFPESDKEALQLEQDYVHRVYEEIARHFSSTRHTPWPHIVEFLKALPSGSLVADIGCGNGKYLGINNELYMIGCDHSQNLVDICRERQYQAFVCDALAVPIRSGSCDACISIAVIHHFATAERRVAALQELVRLLRPGGKALIYVWAMEQEYNKKKSKYLRENRTSQGMKEEISNDASVQELLVKQLPNVGNQDSAHSVSSINDFQDGGCNSKNVANSKLPIHTNRTSFHSQDLLVPWHFKGNPGKDKRVEPFGPLGSRDPGPVFHRYYHVFCEGELEAACRTLNNISILQSYYDQGNWCVILQKV

ALKBH8

Alkylated DNA repair protein alkB homolog 8

664 amino acids

Catalyzes the methylation of 5-carboxymethyl uridine to 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in tRNA via its methyltransferase domain (PubMed:20123966, PubMed:20308323). Catalyzes the last step in the formation of 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in target tRNA (PubMed:20123966, PubMed:20308323). Has a preference for tRNA(Arg) and tRNA(Glu), and does not bind tRNA(Lys)(PubMed:20308323). Binds tRNA and catalyzes the iron and alpha-ketoglutarate dependent hydroxylation of 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in tRNA via its dioxygenase domain, giving rise to 5-(S)-methoxycarbonylhydroxymethyluridine; has a preference for tRNA(Gly) (PubMed:21285950). Required for normal survival after DNA damage (PubMed:20308323). May inhibit apoptosis and promote cell survival and angiogenesis (PubMed:19293182).

Belongs to the alkB family.

75.208 kDa

MDSNHQSNYKLSKTEKKFLRKQIKAKHTLLRHEGIETVSYATQSLVVANGGLGNGVSRNQLLPVLEKCGLVDALLMPPNKPYSFARYRTTEESKRAYVTLNGKEVVDDLGQKITLYLNFVEKVQWKELRPQALPPGLMVVEEIISSEEEKMLLESVDWTEDTDNQNSQKSLKHRRVKHFGYEFHYENNNVDKDKPLSGGLPDICESFLEKWLRKGYIKHKPDQMTINQYEPGQGIPAHIDTHSAFEDEIVSLSLGSEIVMDFKHPDGIAVPVMLPRRSLLVMTGESRYLWTHGITCRKFDTVQASESLKSGIITSDVGDLTLSKRGLRTSFTFRKVRQTPCNCSYPLVCDSQRKETPPSFPESDKEASRLEQEYVHQVYEEIAGHFSSTRHTPWPHIVEFLKALPSGSIVADIGCGNGKYLGINKELYMIGCDRSQNLVDICRERQFQAFVCDALAVPVRSGSCDACISIAVIHHFATAERRVAALQEIVRLLRPGGKALIYVWAMEQEYNKQKSKYLRGNRNSQGKKEEMNSDTSVQRSLVEQMRDMGSRDSASSVPRINDSQEGGCNSRQVSNSKLPVHVNRTSFYSQDVLVPWHLKGNPDKGKPVEPFGPIGSQDPSPVFHRYYHVFREGELEGACRTVSDVRILQSYYDQGNWCVILQKA

ALKBH8

Alkylated DNA repair protein ALKBH8 homolog

346 amino acids

Binds tRNA and catalyzes the iron and alpha-ketoglutarate dependent hydroxylation of 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in tRNA via its dioxygenase domain, giving rise to 5-(S)-methoxycarbonylhydroxymethyluridine.

Belongs to the alkB family.

38.424 kDa

MVQPRFVRPTQSSPSSISGEPNSSNLYVANCGPAVGLTHNAIAAVFAEFGEVNGVYAADDSGVRVIVSFADPFSAKAALEALSGRPCPDLKGRSLHIRYSVLQLPSETQVNDCVPVSLIDSELNIPGLFLLPDFVTVAEEQQLLAAVDARHWIGLAKRRVQHYGYEFCYGTRNVDTKKRLGELPSFVSPILERIYLFPNFDNGSASLNLDQLTVNEYPSGVGLSPHIDTHSAFEDCIFSLSLAGPCIMEFRRYSVSTWKASTTDAEKSGDSSCIKKALYLPPRSMLLLSGEARYAWNHYIPHHKIDKVKDKVIRRSSRRVSFTLRKVRNHPCSCKYPQYCDSQQQM