ALFIN-1

PHD finger protein Alfin1

257 amino acids

Histone-binding component that specifically recognizes H3 tails trimethylated on 'Lys-4' (H3K4me3), which mark transcription start sites of virtually all active genes (By similarity). Transcriptional regulator that binds specifically to DNA sequences 5'-GNGGTG-3' or 5'-GTGGNG-3', including promoter elements of the salt-inducible PRP2 gene. Plays a role in salinity tolerance.

Belongs to the Alfin family.

28.82 kDa

MEGMAQHPVPRTVEEVFSDYKGRRAGLIKALTTDVEKFYQLVDPEKENLCLYGFPNETWEVNLPVEEVPPELPEPALGINFARDGMQEKDWLSLVAVHSDSWLLAVAFYFGARFGFGKNDRKRLFQMINDLPTVFELATGTAKQSKDQLTAHNNGSNSKYKSSGKSRQSESQTKGVKMSAPVKEEVDSGEEEEEDDDEQGATCGACGDNYGTDEFWICCDMCEKWFHGKCVKITPAKAEHIKQYKCPGCSIKKPRIG